KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100386944Help
Entry
100386944         CDS       T03264                                 

Gene name
SUCLG1
Definition
(RefSeq) succinate-CoA ligase alpha subunit
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00020  Citrate cycle (TCA cycle)
cjc00640  Propanoate metabolism
cjc01100  Metabolic pathways
cjc01200  Carbon metabolism
Module
cjc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cjc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100386944 (SUCLG1)
   00640 Propanoate metabolism
    100386944 (SUCLG1)
Enzymes [BR:cjc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     100386944 (SUCLG1)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     100386944 (SUCLG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 100386944
NCBI-ProteinID: XP_002757610
Ensembl: ENSCJAG00000019805
UniProt: U3BBP8
Position
14
AA seq 346 aa AA seqDB search
MTAILTAAVDIATMVSGSSSLAAARLLSRSFLLPQNGIRHCSYTASRKHLYVDKNTKIIC
QGFTGKQGTFHSQQALEYGTKLVGGTTPGKGGQTHLGLPVFNTVKEAKEQTGATASVIYV
PPPFAAAAINEAIEAEIPLVVCITEGIPQQDMVRVKHKLLHQGKTRLIGPNCPGVINPGE
CKIGIMPGHIHKKGRIGIVSRSGTLTYEAVHQTTQVGLGQSLCVGIGGDPFNGTDFIDCL
EIFLNDSATEGIILIGEIGGNAEENAAEFLKQHNSGPNSKPVVSFIAGLTAPPGRRMGHA
GAIIAGGKGGAKEKISALQSAGVVVSMSPAQLGTTIYKEFEKRKML
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcaattcttaccgctgccgttgacatcgcgaccatggtgtccggcagcagcagc
ctagccgccgcccgcctcctgtcgcgcagcttcctcctgccacagaatggaattcggcat
tgttcctatacagcttctcggaaacatctctacgttgataaaaatacaaagattatttgc
cagggtttcactggcaaacagggcacctttcacagccagcaggcattggagtatggcacc
aaacttgttggaggaaccactccagggaaaggaggccagacacatctgggtttaccagtc
tttaacactgtgaaggaggccaaagaacagacaggagcaacggcttctgtcatttatgtt
cctccgccttttgctgcggctgctattaatgaagctattgaggcggaaattcccttggtt
gtgtgtatcactgaaggtatcccacagcaggacatggtccgagttaagcacaaattgctg
caccagggaaagacaaggctaattgggcccaattgccccggagtcatcaatcctggagaa
tgtaaaattggtatcatgcctggtcatattcacaaaaaaggaaggattggcattgtgtcc
agatctggcaccctgacttatgaagcggttcaccaaacaacgcaagttggattggggcag
tctttgtgtgtaggcattggaggtgatccttttaatggaacagattttattgactgcctt
gaaatctttttgaacgattctgccacagaaggcatcatattgattggtgaaattggtggt
aatgccgaagagaatgctgcagaatttttgaagcaacataattcaggtccaaattccaag
cctgtagtgtccttcattgctggtttaactgctcctcctgggaggcgaatgggtcatgca
ggagcaattattgctggaggaaaaggtggagctaaagagaagatatctgcccttcagagt
gcaggagttgtggtcagtatgtctcctgcacagctgggaaccaccatctacaaggaattt
gaaaagaggaagatgctgtga

DBGET integrated database retrieval system