KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100386974Help
Entry
100386974         CDS       T03264                                 

Gene name
SLC7A11
Definition
(RefSeq) solute carrier family 7 member 11
  KO
K13869  solute carrier family 7 (L-type amino acid transporter), member 11
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04216  Ferroptosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    100386974 (SLC7A11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cjc02000]
    100386974 (SLC7A11)
Transporters [BR:cjc02000]
 Solute Carrier Family (SLC)
  SLC7: Cationic amino acid transporter/glycoprotein-associated
   100386974 (SLC7A11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AA_permease_2 AA_permease
Motif
Other DBs
NCBI-GeneID: 100386974
NCBI-ProteinID: XP_002745397
Ensembl: ENSCJAG00000003185
UniProt: F7IFK5
Position
3
AA seq 501 aa AA seqDB search
MVRKPVVSTISKGSYLQGNVNGRLPSLGNKEPPGKEKVQLKRKVTLLRGISIIIGTIIGA
GIFISPKGVLENTGSVGMSLTIWTVCGVLSLFGALSYAELGTSIKKSGGHYTYILEVFGP
LPAFVRVWVELLVIRPAATAVISLAFGRYILEPFFIQCEIPALAIKLITAVGITVVMVLN
SMSVSWSARIQIVLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFY
YGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMVIVTIGYVLTNVAYFTTINAEELLLS
DAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHV
HKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRP
FKIPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDKKPRWFRIM
SERITRSLQIILEVVPEEDKL
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggtcagaaagcctgttgtgtccaccatctccaaaggaagttacctgcagggaaatgtt
aacgggaggctgccttccctgggcaacaaggagccacctgggaaggagaaagtgcagctg
aagaggaaagtcactttactgaggggaatctccattatcattggcaccatcattggagca
ggaatcttcatttctcctaagggcgtgctggagaacacaggcagcgtgggcatgtctctg
accatctggacagtgtgtggggtcctgtcactgtttggagccttgtcttatgctgaattg
ggaacaagtataaagaaatccggaggtcattacacatatattttggaagtctttggtcca
ttaccagcttttgtacgagtctgggtggaactgctcgtaatacgccctgcagctactgct
gtgatatccctggcgtttggacgctacattctggaaccattttttattcaatgtgaaatc
cctgcacttgcaatcaagctcattacagctgtgggcataactgtggtgatggtcctaaat
agcatgagtgtcagctggagtgcccggatccagattgtcttaaccttttgcaagctcaca
gcaattctgataattatagtccctggagttatgcagctaattaaaggtcaaacgcagaac
tttaaagacgccttttcaggaagagattccagtattacacggttgcccctggctttttat
tacggaatgtatgcctatgctggctggttttacctcaattttgtaactgaagaagtagaa
aaccctgaaaaaaccattccccttgcaatatgtatatccatggtcattgtcaccattggc
tatgtgctgacaaatgtggcctactttacgaccattaatgctgaggagctgttgctttca
gatgcagtggcagtgaccttttctgagcggctactgggaaatttctcattagcagttccg
atctttgttgccctctcctgctttggctccatgaatggtggtgtgtttgctgtctccagg
ttattctatgttgcgtctcgagagggtcaccttccagaaattctctccatgattcatgtc
cacaagcacactcctctgccagctgttattgttttgcaccctttgacaatgataatgctc
ttctctggagacctcgacagtcttttgaatttcctcagttttgccaggtggctttttatt
gggctggcagttgctgggctgatttatcttcgatacaaatgcccagatatgcatcgtcct
ttcaagatcccgctgttcatcccagctttgttttccttcacgtgcctcttcatggttgcc
ctttccctctattcggacccatttagcacaggcattggcttcgtcatcactctgaccggg
gtgcctgcatattatctctttattatatgggacaagaaacccaggtggtttaggataatg
tcagagagaataaccagatcattgcaaataattctggaagttgtaccagaagaagataaa
ttatga

DBGET integrated database retrieval system