KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100387043Help
Entry
100387043         CDS       T03264                                 

Gene name
HSPA2
Definition
(RefSeq) heat shock protein family A (Hsp70) member 2
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03040  Spliceosome
cjc04010  MAPK signaling pathway
cjc04141  Protein processing in endoplasmic reticulum
cjc04144  Endocytosis
cjc04213  Longevity regulating pathway - multiple species
cjc04612  Antigen processing and presentation
cjc04915  Estrogen signaling pathway
cjc05134  Legionellosis
cjc05145  Toxoplasmosis
cjc05162  Measles
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100387043 (HSPA2)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100387043 (HSPA2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100387043 (HSPA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100387043 (HSPA2)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    100387043 (HSPA2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100387043 (HSPA2)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    100387043 (HSPA2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100387043 (HSPA2)
  09172 Infectious disease: viral
   05162 Measles
    100387043 (HSPA2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100387043 (HSPA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cjc01009]
    100387043 (HSPA2)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cjc03041]
    100387043 (HSPA2)
   03009 Ribosome biogenesis [BR:cjc03009]
    100387043 (HSPA2)
   03110 Chaperones and folding catalysts [BR:cjc03110]
    100387043 (HSPA2)
   04131 Membrane trafficking [BR:cjc04131]
    100387043 (HSPA2)
   03051 Proteasome [BR:cjc03051]
    100387043 (HSPA2)
   03029 Mitochondrial biogenesis [BR:cjc03029]
    100387043 (HSPA2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100387043 (HSPA2)
Protein phosphatases and associated proteins [BR:cjc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100387043 (HSPA2)
Spliceosome [BR:cjc03041]
 Complex B
  Other components
   Prp19 complex
    100387043 (HSPA2)
 Complex C
   Prp19-CDC5 complex
    100387043 (HSPA2)
Ribosome biogenesis [BR:cjc03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    100387043 (HSPA2)
Chaperones and folding catalysts [BR:cjc03110]
 Heat shock proteins
  HSP70 / DNAK
   100387043 (HSPA2)
Membrane trafficking [BR:cjc04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    100387043 (HSPA2)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    100387043 (HSPA2)
Proteasome [BR:cjc03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    100387043 (HSPA2)
Mitochondrial biogenesis [BR:cjc03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    100387043 (HSPA2)
Exosome [BR:cjc04147]
 Exosomal proteins
  Proteins found in most exosomes
   100387043 (HSPA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C CRIC_ras_sig DUF1464 DDR Zincin_2
Motif
Other DBs
NCBI-GeneID: 100387043
NCBI-ProteinID: XP_017832642
UniProt: U3BYK3
Position
10
AA seq 641 aa AA seqDB search
MSARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
AMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEI
SSMVLTKMKEIAEAYLGGKVHSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAA
AIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRM
VSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSI
TRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGK
ELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRN
TTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVT
FDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVA
AKNAVESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVISWLDRNQMAEKDEFEHKQK
ELERICNPIISKLYQGGPGSGGGGSGGGSGASGGPTIEEVD
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcccgcggcccggctatcggcatcgacctgggcaccacctactcgtgcgtgggg
gttttccaacatggcaaagtggaaatcatcgccaacgaccagggcaaccgcaccaccccc
agctacgtggccttcacggacaccgagcgcctcatcggcgacgccgccaagaaccaggtg
gccatgaaccccaccaacaccatcttcgacgccaagaggctgatcggacggaagttcgag
gacgccaccgtgcagtcggacatgaaacactggccgttccgggtagtgagcgagggaggc
aagcccaaagtgcaagtggagtacaagggggagaccaagaccttcttcccggaggagata
tcctccatggtcctcacgaagatgaaggagatcgcagaagcctacctggggggcaaggtg
cacagcgcggtcatcacggtcccggcctatttcaacgactcgcagcgccaggccaccaag
gacgcgggcaccatcacggggctcaacgtgctgcgaatcatcaacgagcccacggcggcg
gccatagcctacggcctcgacaagaagggctgcgcgggcggcgagaagaacgtgctcatc
tttgacctgggcggaggcaccttcgacgtgtccattctgaccatcgaggatggcatcttc
gaggtgaagtccacggccggcgacacccacctgggcggcgaggacttcgacaaccgcatg
gtgagccacctggcggaggagttcaaacgcaagcacaagaaggacattgggcccaacaag
cgcgccgtcaggcggctgcgcaccgcctgcgagcgcgccaagcgcaccctgagctcgtcc
acacaggcgagcatcgagatcgactcgctctacgagggcgtggacttctacacgtccatc
acccgcgcccgcttcgaggagcttaacgccgacctcttccgagggaccctggagccggtg
gagaaggcgctgcgcgacgccaagctggacaagggccagatccaggagattgtgctggtg
ggcggctccactcgtatccccaagatccagaagctgctgcaggatttcttcaacggcaag
gagctgaacaagagcatcaaccccgacgaggcggtggcctatggcgccgcagtgcaggcg
gccatcctcatcggtgacaaatcggagaacgtgcaggacctgctgctactcgacgtgacc
ccgctgtcgctgggcatcgagacagctggcggtgtcatgaccccactcatcaagaggaac
accacgatccccaccaagcagacgcagaccttcaccacctactcagacaaccagagcagc
gtgctggtgcaggtatatgagggcgaacgggccatgaccaaggacaataacctgctgggc
aagttcgacctgaccgggattccccctgctccccgcggggtcccccagatcgaggttacc
ttcgacatcgacgccaacggcatccttaacgttaccgccgccgacaagagcaccggtaag
gaaaacaaaatcaccattaccaacgacaaaggtcgtctgagcaaggacgacattgaccgg
atggtgcaggaggcggagcggtacaagtcagaggatgaggcgaatcgtgaccgagtcgcg
gccaaaaacgccgtggagtcctatacctacaacatcaagcagacggtggaagacgagaaa
ctgagaggcaagattagcgagcaggacaaaaacaagatcctcgacaagtgtcaggaggtg
atcagctggctcgaccgaaaccagatggcagaaaaagatgagtttgaacacaagcagaaa
gagctcgaaagaatttgcaaccccatcatcagcaaactttaccaaggtggtcctggcagc
ggcggcggcggcagcggcggaggttcaggagcctccgggggaccgaccatcgaagaagtg
gactaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100389824Help
Entry
100389824         CDS       T03264                                 

Gene name
HSPA8
Definition
(RefSeq) heat shock protein family A (Hsp70) member 8
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03040  Spliceosome
cjc04010  MAPK signaling pathway
cjc04141  Protein processing in endoplasmic reticulum
cjc04144  Endocytosis
cjc04213  Longevity regulating pathway - multiple species
cjc04612  Antigen processing and presentation
cjc04915  Estrogen signaling pathway
cjc05134  Legionellosis
cjc05145  Toxoplasmosis
cjc05162  Measles
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100389824 (HSPA8)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100389824 (HSPA8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100389824 (HSPA8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100389824 (HSPA8)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    100389824 (HSPA8)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100389824 (HSPA8)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    100389824 (HSPA8)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100389824 (HSPA8)
  09172 Infectious disease: viral
   05162 Measles
    100389824 (HSPA8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100389824 (HSPA8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cjc01009]
    100389824 (HSPA8)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cjc03041]
    100389824 (HSPA8)
   03009 Ribosome biogenesis [BR:cjc03009]
    100389824 (HSPA8)
   03110 Chaperones and folding catalysts [BR:cjc03110]
    100389824 (HSPA8)
   04131 Membrane trafficking [BR:cjc04131]
    100389824 (HSPA8)
   03051 Proteasome [BR:cjc03051]
    100389824 (HSPA8)
   03029 Mitochondrial biogenesis [BR:cjc03029]
    100389824 (HSPA8)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100389824 (HSPA8)
Protein phosphatases and associated proteins [BR:cjc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100389824 (HSPA8)
Spliceosome [BR:cjc03041]
 Complex B
  Other components
   Prp19 complex
    100389824 (HSPA8)
 Complex C
   Prp19-CDC5 complex
    100389824 (HSPA8)
Ribosome biogenesis [BR:cjc03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    100389824 (HSPA8)
Chaperones and folding catalysts [BR:cjc03110]
 Heat shock proteins
  HSP70 / DNAK
   100389824 (HSPA8)
Membrane trafficking [BR:cjc04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    100389824 (HSPA8)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    100389824 (HSPA8)
Proteasome [BR:cjc03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    100389824 (HSPA8)
Mitochondrial biogenesis [BR:cjc03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    100389824 (HSPA8)
Exosome [BR:cjc04147]
 Exosomal proteins
  Proteins found in most exosomes
   100389824 (HSPA8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DDR HORMA MetOD2
Motif
Other DBs
NCBI-GeneID: 100389824
NCBI-ProteinID: XP_002754570
Ensembl: ENSCJAG00000007648
Position
11
AA seq 699 aa AA seqDB search
MAGIRGGPLLEGSETGYKRRAGGRKPVSLNSPCSSRDYCGILRFPGQAYTPATMSKGPAV
GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTV
FDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKM
KEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDK
KVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKR
KHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNA
DLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDE
AVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQT
FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILN
VSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAF
NMKATVEDEKLQGKINDEDKQKILDKCNEIINWLVKNQTAEKEEFEHQQKELEKVCNPII
TKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcatcaggggcgggccccttctggaaggttctgagaccgggtataagaggcgg
gctggcgggcggaaaccggtctcactgaactccccctgcagctctcgagattactgtggt
attcttcgttttccgggccaggcctacacgccagcaaccatgtcgaagggacctgccgtt
ggtattgatcttggcaccacctactcctgtgtgggtgttttccagcacggaaaagtagaa
ataattgccaatgatcaaggaaaccgaaccactccaagctatgtcgcctttacggacact
gaacgattgatcggtgatgccgcaaagaatcaagttgcaatgaaccccaccaacacggtt
tttgatgccaaacgtctgattggacgcagatttgatgatgccgttgtccagtctgatatg
aagcattggccctttatggtggtgaatgatgctggcaggcccaaggtccaagtagaatac
aagggagagacaaaaagcttctatccagaggaggtatcctctatggttctgacaaagatg
aaggaaattgcagaagcctaccttgggaagactgttaccaatgctgtggtcacagtgccc
gcttactttaatgactctcagcgtcaggctaccaaagatgctggaactattgctggtctc
aatgtacttagaattattaatgagccaactgctgctgctattgcttatggcttagacaaa
aaggttggagctgagagaaacgtgctgatctttgatctcggaggtggcacttttgatgtg
tcaatcctcactattgaggatggaatctttgaggtcaagtctacagccggagacacccac
ttgggtggagaagattttgataaccgaatggtcaaccatttcattgctgagttcaagcgc
aagcataagaaggacataagtgagaacaagagagctgtaagacgcctccgtactgcttgt
gagcgtgctaagcgtactctctcttccagcacccaggctagtattgagatcgattcccta
tatgagggaatcgacttctatacctccattacccgtgcccgatttgaagaattgaatgct
gacttgttccgtggaaccctggaccccgtagagaaggcccttcgagatgccaaactagac
aagtctcaaattcatgatattgtcctggttggtggttctactcgcatccccaaaattcag
aagcttctccaagactttttcaatggaaaagaactgaataagagcatcaaccctgatgaa
gctgttgcttatggtgcagctgtccaggccgccattctgtctggagataagtctgaaaat
gttcaagatttgctgctcttggatgtcactcctctttcccttggcattgaaactgctggt
ggagtcatgaccgtcctcatcaagcgtaatactaccattcccaccaagcagacacagacc
ttcactacctattccgacaaccagcctggtgtgcttattcaggtttatgaaggtgagcgt
gccatgaccaaggataacaacctgcttggcaagtttgaacttacaggcatacctcctgca
ccccgaggtgttcctcagattgaggtcacttttgacattgatgccaatggcattctcaat
gtgtctgctgtggacaagagtacaggaaaagagaacaagattactatcactaatgacaag
ggccgtttgagcaaggaagacattgaacgtatggtccaggaagctgagaagtacaaagct
gaagatgagaagcagagggacaaagtgtcatctaagaattcgcttgaatcctatgcattc
aacatgaaagcaactgttgaagatgagaaacttcaaggcaagattaacgatgaggataaa
cagaagattctggacaagtgtaatgaaattatcaactggcttgttaagaatcagactgcc
gagaaggaagaatttgaacatcagcaaaaagagctggagaaagtctgcaaccccatcatc
accaagctgtaccagagtgcaggaggcatgccaggaggaatgcctggaggattccctggt
ggtggagctcctccctctggtggtgcttcctcagggcccactattgaagaggttgattaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100393753Help
Entry
100393753         CDS       T03264                                 

Gene name
HSPA1L
Definition
(RefSeq) heat shock protein family A (Hsp70) member 1 like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03040  Spliceosome
cjc04010  MAPK signaling pathway
cjc04141  Protein processing in endoplasmic reticulum
cjc04144  Endocytosis
cjc04213  Longevity regulating pathway - multiple species
cjc04612  Antigen processing and presentation
cjc04915  Estrogen signaling pathway
cjc05134  Legionellosis
cjc05145  Toxoplasmosis
cjc05162  Measles
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100393753 (HSPA1L)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100393753 (HSPA1L)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100393753 (HSPA1L)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100393753 (HSPA1L)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    100393753 (HSPA1L)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100393753 (HSPA1L)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    100393753 (HSPA1L)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100393753 (HSPA1L)
  09172 Infectious disease: viral
   05162 Measles
    100393753 (HSPA1L)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100393753 (HSPA1L)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cjc01009]
    100393753 (HSPA1L)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cjc03041]
    100393753 (HSPA1L)
   03009 Ribosome biogenesis [BR:cjc03009]
    100393753 (HSPA1L)
   03110 Chaperones and folding catalysts [BR:cjc03110]
    100393753 (HSPA1L)
   04131 Membrane trafficking [BR:cjc04131]
    100393753 (HSPA1L)
   03051 Proteasome [BR:cjc03051]
    100393753 (HSPA1L)
   03029 Mitochondrial biogenesis [BR:cjc03029]
    100393753 (HSPA1L)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100393753 (HSPA1L)
Protein phosphatases and associated proteins [BR:cjc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100393753 (HSPA1L)
Spliceosome [BR:cjc03041]
 Complex B
  Other components
   Prp19 complex
    100393753 (HSPA1L)
 Complex C
   Prp19-CDC5 complex
    100393753 (HSPA1L)
Ribosome biogenesis [BR:cjc03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    100393753 (HSPA1L)
Chaperones and folding catalysts [BR:cjc03110]
 Heat shock proteins
  HSP70 / DNAK
   100393753 (HSPA1L)
Membrane trafficking [BR:cjc04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    100393753 (HSPA1L)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    100393753 (HSPA1L)
Proteasome [BR:cjc03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    100393753 (HSPA1L)
Mitochondrial biogenesis [BR:cjc03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    100393753 (HSPA1L)
Exosome [BR:cjc04147]
 Exosomal proteins
  Proteins found in most exosomes
   100393753 (HSPA1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Radial_spoke_3
Motif
Other DBs
NCBI-GeneID: 100393753
NCBI-ProteinID: XP_008992430
Position
4
AA seq 579 aa AA seqDB search
MNPQNTVFDAKRLIGRKFNDPVVQSDMKLWPFQVINEGGKPKVLVSYKGENKAFYPEEIS
SMVLTKMKETAEAFLGHPITNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAA
IAYGLDKGGQGERHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSH
FVEEFKRKHKKDIGQNKRAVRRLRTACERAKRTLSSSTQANLEIDSFYEGIDFYTSITRA
RFEELCADLFRGTLEPVEKALRDAKMDKAKIHDIVLVGGSTRIPKVQRLLQDHFNGRDLN
KSINPDEAVAYGAAVQAAILDGDKSEKVQDLLLLDVSPLSLGLETAGGVMTVLIKRNSTI
PTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFDLTGIPPAPRGVPQIEVTFDI
DANGILNVTAMDKSTGKANKITITNDKGRLSKEEIERMVLDAEKYKAEDEVQREKIAAKN
ALESYAFNMKSAVSDEGLKGKISESDKKKILDKCNEVLSWLEANQLAEKDEFDHKRKELE
QMCNPIITKLYQGGCTGPTCGTGYVPGGPTTGPTIEEVD
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgaatccccagaacactgtctttgatgccaaacgtctgatcggcaggaaatttaatgat
cctgttgtgcaatcagatatgaaactttggccttttcaagtgatcaatgaaggaggcaag
cccaaagtgcttgtgtcctacaaaggggagaataaagctttctaccctgaggaaatctct
tcgatggtgctaactaagatgaaggagactgctgaggcttttttgggccaccctatcacc
aatgcagtgattactgtgccagcctatttcaatgactctcaacgtcaggccactaaggat
gcaggtgtgattgctggactcaatgtgctaagaatcatcaatgagcccacagctgctgcc
attgcctatggtttagataaaggaggtcaaggagaacgacatgtcttgatctttgatctg
ggtggaggcacatttgatgtgtcaattctgaccatagatgatgggatttttgaggtaaag
gccactgctggggacacccacctgggtggggaggactttgacaacaggcttgtgagccac
ttcgtagaagagttcaagaggaagcacaagaaggacatcggccagaataagcgagctgtt
aggcggctgcgcaccgcctgtgagagggccaagaggactctgtcatccagcacccaggcc
aacctagaaatagattcattttatgaaggcattgacttctacacatccatcaccagagct
cgatttgaagagttgtgtgcagacctgtttaggggcaccctggagcctgtagaaaaagct
cttcgggatgccaagatggataaggctaaaatccatgacattgttttagtaggggggtcc
acccgcatccccaaggtgcagcggctgcttcaggaccactttaatggacgtgatctcaat
aagagcatcaaccctgatgaagcagtagcatatggggctgctgtgcaggcagccatcctg
gatggggacaagtctgagaaggtacaggacctgctgctgcttgatgtgtctccactgtcg
ctggggctggagacggcagggggcgtgatgactgtcctgatcaagcgcaactccaccatc
cccaccaaacagacgcagatcttcaccacctactccgacaaccagcccggggtgctgatc
caggtgtatgagggcgagagggctatgacgaaggacaacaacctgctggggcgctttgac
ctgactggaatccctccagcacccaggggagttcctcagatcgaggtgacctttgacatt
gatgccaatggtattcttaatgtcacagccatggacaagagcacaggcaaggccaacaag
atcaccatcaccaatgacaagggccgcctgagcaaggaggagattgagcgcatggttctg
gatgctgagaaatacaaagctgaagatgaggtccagagggagaaaattgctgcaaagaat
gccttagaatcctatgcttttaacatgaagagtgctgtgagtgatgaaggtttgaagggc
aagattagtgagtctgataaaaagaaaatactggataaatgcaacgaggtcctttcatgg
ctggaggccaatcaactggcagagaaagatgagtttgatcataagagaaaggaattggag
cagatgtgtaaccccatcatcacaaaactctaccaaggaggatgcactgggcctacctgt
ggaactggatatgtgcctggagggcctaccacaggccccacaattgaagaagtagattaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100406069Help
Entry
100406069         CDS       T03264                                 

Gene name
HSPA1A, HSPA1B
Definition
(RefSeq) heat shock protein family A (Hsp70) member 1A
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03040  Spliceosome
cjc04010  MAPK signaling pathway
cjc04141  Protein processing in endoplasmic reticulum
cjc04144  Endocytosis
cjc04213  Longevity regulating pathway - multiple species
cjc04612  Antigen processing and presentation
cjc04915  Estrogen signaling pathway
cjc05134  Legionellosis
cjc05145  Toxoplasmosis
cjc05162  Measles
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100406069 (HSPA1A)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100406069 (HSPA1A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100406069 (HSPA1A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100406069 (HSPA1A)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    100406069 (HSPA1A)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100406069 (HSPA1A)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    100406069 (HSPA1A)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100406069 (HSPA1A)
  09172 Infectious disease: viral
   05162 Measles
    100406069 (HSPA1A)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100406069 (HSPA1A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cjc01009]
    100406069 (HSPA1A)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cjc03041]
    100406069 (HSPA1A)
   03009 Ribosome biogenesis [BR:cjc03009]
    100406069 (HSPA1A)
   03110 Chaperones and folding catalysts [BR:cjc03110]
    100406069 (HSPA1A)
   04131 Membrane trafficking [BR:cjc04131]
    100406069 (HSPA1A)
   03051 Proteasome [BR:cjc03051]
    100406069 (HSPA1A)
   03029 Mitochondrial biogenesis [BR:cjc03029]
    100406069 (HSPA1A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100406069 (HSPA1A)
Protein phosphatases and associated proteins [BR:cjc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100406069 (HSPA1A)
Spliceosome [BR:cjc03041]
 Complex B
  Other components
   Prp19 complex
    100406069 (HSPA1A)
 Complex C
   Prp19-CDC5 complex
    100406069 (HSPA1A)
Ribosome biogenesis [BR:cjc03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    100406069 (HSPA1A)
Chaperones and folding catalysts [BR:cjc03110]
 Heat shock proteins
  HSP70 / DNAK
   100406069 (HSPA1A)
Membrane trafficking [BR:cjc04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    100406069 (HSPA1A)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    100406069 (HSPA1A)
Proteasome [BR:cjc03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    100406069 (HSPA1A)
Mitochondrial biogenesis [BR:cjc03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    100406069 (HSPA1A)
Exosome [BR:cjc04147]
 Exosomal proteins
  Proteins found in most exosomes
   100406069 (HSPA1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Radial_spoke_3
Motif
Other DBs
NCBI-GeneID: 100406069
NCBI-ProteinID: XP_017826465
UniProt: U3F8F4
Position
4
AA seq 641 aa AA seqDB search
MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
LNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEIS
SMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAA
IAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNH
FVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRA
RFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLN
KSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTI
PTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDI
DANGILNVTAMDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKN
ALESYAFNMKSAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELE
QVCNPIISGLYQGAGGPGPGGFGAQGPKGGSGSGPTIEEVD
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagccgcggcgattggcattgacctgggcaccacctactcctgcgtgggggtg
ttccagcacggcaaggtggagatcatcgccaacgaccagggcaaccgcaccacccccagt
tacgtggccttcacggacaccgagcggctcatcggggatgcggccaagaaccaggtggcg
ctgaacccgcagaacaccgtgtttgacgcgaagcggctgatcggccgcaagttcggcgac
ccggtggtgcagtcggacatgaagcactggccgttccaggtgatcaacgacggagacaag
cccaaggtgcaggtgagctacaagggggagaccaaggcgttctaccccgaggagatctcg
tccatggtgctgaccaaaatgaaggagatcgccgaggcgtacctgggctatccggtgacc
aacgcggtgatcaccgtgccggcctacttcaacgactcgcagcgccaggccaccaaggat
gcgggggtgatcgcggggctcaacgttctgcggatcatcaacgagcccacggcggccgcc
atcgcctacggcctggaccgaaccggcaagggggagcgcaacgtgctcatctttgacctg
ggcgggggcaccttcgacgtgtccatcctgaccatcgacgacggcatcttcgaggtgaag
gccacggccggggacacccacttgggtggggaggactttgacaacaggctggtgaaccac
ttcgtggaggagttcaagaggaaacacaagaaggacatcagccagaacaagcgagccgtg
aggcggctgcgcactgcctgcgagagggccaagaggaccctgtcgtccagcacccaggcc
agcctggagatcgactccctgtttgagggcatcgacttctacacgtccatcaccagggcg
aggttcgaggagctgtgctcggacctgttccgaagcaccctggagcccgtggagaaggct
ctgcgagacgccaagctggacaaggcccagatccacgacctggtcctggtcgggggctct
acccgcatccccaaggtgcagaagctgctgcaggacttcttcaacgggcgcgacctgaac
aagagcatcaaccccgacgaggctgtggcctatggggcggcggtgcaggcagccatcctg
atgggggacaagtccgagaacgtgcaggacctgctgctgctggacgtggctcccctgtcg
ctggggctggagacggccgggggcgtgatgactgccctgatcaagcgcaactccaccatc
cccacgaagcagacgcagatcttcaccacctactccgacaaccagcccggggtgctgatc
caggtgtatgagggcgagagggccatgaccaaggacaacaacctgttggggcgcttcgag
ctgagcggcatccctccggcccccagaggcgtgccccagatcgaggtgaccttcgacatc
gacgccaacggcatcctgaacgtcacggccatggacaagagcacgggcaaagccaacaag
atcaccatcaccaacgacaagggccgcctgagcaaggaggagatcgagcgcatggtgcag
gaggcggagaagtacaaggcggaggacgaggtgcagcgcgagagggtttcagccaagaat
gccctggagtcgtacgccttcaacatgaagagcgccgtggaggatgaggggctcaagggc
aagatcagcgaggcggacaagaagaaggtgctggacaagtgtcaggaggtcatctcgtgg
ctggacgccaacaccctggccgagaaggacgagtttgagcacaagaggaaagagctggag
caggtgtgtaaccccatcatcagcggactgtaccagggtgcgggtggtcccggtcctggg
ggctttggggctcaaggtcccaagggagggtctgggtcaggccccacgattgaggaggtg
gattag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100407165Help
Entry
100407165         CDS       T03264                                 

Definition
(RefSeq) heat shock 70 kDa protein 1-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03040  Spliceosome
cjc04010  MAPK signaling pathway
cjc04141  Protein processing in endoplasmic reticulum
cjc04144  Endocytosis
cjc04213  Longevity regulating pathway - multiple species
cjc04612  Antigen processing and presentation
cjc04915  Estrogen signaling pathway
cjc05134  Legionellosis
cjc05145  Toxoplasmosis
cjc05162  Measles
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100407165
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100407165
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100407165
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100407165
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    100407165
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100407165
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    100407165
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100407165
  09172 Infectious disease: viral
   05162 Measles
    100407165
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100407165
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cjc01009]
    100407165
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cjc03041]
    100407165
   03009 Ribosome biogenesis [BR:cjc03009]
    100407165
   03110 Chaperones and folding catalysts [BR:cjc03110]
    100407165
   04131 Membrane trafficking [BR:cjc04131]
    100407165
   03051 Proteasome [BR:cjc03051]
    100407165
   03029 Mitochondrial biogenesis [BR:cjc03029]
    100407165
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100407165
Protein phosphatases and associated proteins [BR:cjc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100407165
Spliceosome [BR:cjc03041]
 Complex B
  Other components
   Prp19 complex
    100407165
 Complex C
   Prp19-CDC5 complex
    100407165
Ribosome biogenesis [BR:cjc03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    100407165
Chaperones and folding catalysts [BR:cjc03110]
 Heat shock proteins
  HSP70 / DNAK
   100407165
Membrane trafficking [BR:cjc04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    100407165
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    100407165
Proteasome [BR:cjc03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    100407165
Mitochondrial biogenesis [BR:cjc03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    100407165
Exosome [BR:cjc04147]
 Exosomal proteins
  Proteins found in most exosomes
   100407165
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C MIF4G DDR Hydantoinase_A Pox_D5
Motif
Other DBs
NCBI-GeneID: 100407165
NCBI-ProteinID: XP_017826467
Position
4
AA seq 438 aa AA seqDB search
MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
LNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEIS
SMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAA
IAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNH
FVEEFKRKHKKDISQNKRALRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRA
RFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLN
NSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRTPPS
PRSRRRSSPPTPTTSPGC
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagccgcggcgatcggcattgacctgggcaccacctactcctgcgtcggggtg
ttccagcacggcaaggtggagatcatcgccaacgaccagggcaaccgcaccacccccagt
tacgtggccttcacggacaccgagcggctcatcggggatgcggccaagaaccaggtggcg
ctgaacccgcagaacaccgtgtttgacgcgaagcggctgatcggccgcaagttcggcgac
ccggtggtgcagtcggacatgaagcactggccgttccaggtgatcaacgacggagacaag
cccaaggtgcaggtgagctacaagggggagaccaaggcgttctaccccgaggagatctcg
tccatggtgctgaccaagatgaaggagatcgccgaggcgtacctgggctatccggtgacc
aacgcggtgatcaccgtgccggcctacttcaacgactcgcagcgccaggccaccaaggat
gcgggggtgatcgcggggctcaacgttctgcggatcatcaacgagcccacggcggccgcc
atcgcctacggcctggaccgaaccggcaagggggagcgcaacgtgctcatctttgacctg
ggcgggggcaccttcgacgtgtccatcctgaccatcgacgacggcatcttcgaggtgaag
gccacggccggggacacccacttgggtggggaggactttgacaacaggctggtgaaccac
ttcgtggaagagttcaagaggaaacacaagaaggacatcagccagaacaagcgagccttg
aggcggctgcgcactgcctgcgagagggccaagaggaccctgtcgtccagcacccaggcc
agcctggagatcgactccctgtttgagggcatcgacttctacacgtccatcaccagggcg
aggttcgaggagctgtgctcggacctgttccgaagcaccctggagcccgtggagaaggct
ctgcgagacgccaagctggacaaggcccagatccacgacctggtcctggtcgggggctct
acccgcatccccaaggtgcagaagctgctgcaggacttcttcaacgggcgcgacctgaac
aatagcatcaaccccgacgaggctgtggcctatggggcggcggtgcaggcagccatcctg
atgggggacaagtccgagaacgtgcaggacctgctgctgctggacgtggctcccctgtcg
ctggggctggagacggccgggggcgtgatgactgccctgatcaagcgcactccaccatcc
ccacgaagcagacgcagatcttcaccacctactccgacaaccagcccggggtgctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100411854Help
Entry
100411854         CDS       T03264                                 

Gene name
HSPA6
Definition
(RefSeq) heat shock protein family A (Hsp70) member 6
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03040  Spliceosome
cjc04010  MAPK signaling pathway
cjc04141  Protein processing in endoplasmic reticulum
cjc04144  Endocytosis
cjc04213  Longevity regulating pathway - multiple species
cjc04612  Antigen processing and presentation
cjc04915  Estrogen signaling pathway
cjc05134  Legionellosis
cjc05145  Toxoplasmosis
cjc05162  Measles
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100411854 (HSPA6)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100411854 (HSPA6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100411854 (HSPA6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100411854 (HSPA6)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    100411854 (HSPA6)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100411854 (HSPA6)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    100411854 (HSPA6)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100411854 (HSPA6)
  09172 Infectious disease: viral
   05162 Measles
    100411854 (HSPA6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100411854 (HSPA6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cjc01009]
    100411854 (HSPA6)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cjc03041]
    100411854 (HSPA6)
   03009 Ribosome biogenesis [BR:cjc03009]
    100411854 (HSPA6)
   03110 Chaperones and folding catalysts [BR:cjc03110]
    100411854 (HSPA6)
   04131 Membrane trafficking [BR:cjc04131]
    100411854 (HSPA6)
   03051 Proteasome [BR:cjc03051]
    100411854 (HSPA6)
   03029 Mitochondrial biogenesis [BR:cjc03029]
    100411854 (HSPA6)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100411854 (HSPA6)
Protein phosphatases and associated proteins [BR:cjc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100411854 (HSPA6)
Spliceosome [BR:cjc03041]
 Complex B
  Other components
   Prp19 complex
    100411854 (HSPA6)
 Complex C
   Prp19-CDC5 complex
    100411854 (HSPA6)
Ribosome biogenesis [BR:cjc03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    100411854 (HSPA6)
Chaperones and folding catalysts [BR:cjc03110]
 Heat shock proteins
  HSP70 / DNAK
   100411854 (HSPA6)
Membrane trafficking [BR:cjc04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    100411854 (HSPA6)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    100411854 (HSPA6)
Proteasome [BR:cjc03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    100411854 (HSPA6)
Mitochondrial biogenesis [BR:cjc03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    100411854 (HSPA6)
Exosome [BR:cjc04147]
 Exosomal proteins
  Proteins found in most exosomes
   100411854 (HSPA6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl Hydantoinase_A DDR
Motif
Other DBs
NCBI-GeneID: 100411854
NCBI-ProteinID: XP_008983032
Position
18
AA seq 382 aa AA seqDB search
MQAPRELAVGIDLGTTYSCVGVFQQGRVEILANDQGNRTTPSYVAFTDTERLVGDAAKSQ
AALNPLNTVFDAKRLIGRKFEDATVQADMKHWPFQVVSEGCKPKVRVSYRGEDKAFYPEE
ISSMVLSKMKETAEAYLGQPVKHAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTA
AAIAYGLDRRGAGERNVLIFDLGGGTFDVSILSIDAGVFEVKATAGDTHLGGEDFDNRLV
NHFVEEFRRKHRKDLSGNKRALRRLRTACERAKRTLSSSTQATLEIDSLFEGVDFYTSIT
RARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDVVLVGGSTRIPRVQKLLQDFFNGKE
LNKSINPDEAVALWGCCAGRPC
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccccacgggagctggcggtgggcatcgacctgggcaccacctactcgtgcgtg
ggcgtgttccagcagggccgcgtggagatcctggccaacgaccagggcaaccgcaccacg
cccagctacgtggccttcactgacaccgagcggctggtcggggatgcggccaagagccag
gcggccctgaaccctctcaacacggtgttcgacgctaagcggctgatcgggcgcaagttc
gaggacgccacggtgcaggcggacatgaagcactggcccttccaggtggtgagcgagggc
tgcaagcccaaggtgcgcgtgtcctaccgcggggaggacaaggcgttctaccccgaggag
atctcgtccatggttctgagcaagatgaaagagacggccgaggcgtacctgggccagccc
gtgaagcacgctgtgatcaccgtgcccgcctacttcaatgactcgcagcgccaggccacc
aaggacgcgggcgccatcgcggggctcaacgtgctgcggatcatcaacgagcccacggcg
gccgccatcgcctatgggctggaccggcgcggcgctggagagcgcaacgtgctcattttt
gacctgggcgggggcaccttcgacgtgtccattctctccattgacgccggtgtctttgag
gtgaaagccactgctggagacacccacctgggtggagaggacttcgacaaccggctggtg
aaccacttcgtggaagaattccggcggaagcatcggaaggacctgagcgggaacaagcgg
gccctgcgtaggctgcgtacagcctgtgagcgcgccaagcgcaccctgtcctccagcacc
caggccaccctggagattgactccctgttcgagggcgtggacttctacacgtccatcact
cgtgcccgctttgaggaactgtgctcagacctcttccgcagcactctggagccggtagag
aaggccctgcgggatgccaagctggacaaggcccagatccatgacgtcgtcctggtgggg
ggctccactcgcatccccagggtgcagaagttgctgcaggacttcttcaacggcaaggag
ctgaacaagagcatcaaccccgatgaggctgtggccctatggggctgctgtgcagggcgg
ccgtgttga

DBGET integrated database retrieval system