KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100387132Help
Entry
100387132         CDS       T03264                                 

Definition
(RefSeq) nucleotide-binding oligomerization domain-containing protein 2-like
  KO
K10165  nucleotide-binding oligomerization domain-containing protein 2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04621  NOD-like receptor signaling pathway
cjc04668  TNF signaling pathway
cjc05152  Tuberculosis
cjc05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100387132
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100387132
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    100387132
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100387132
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:cjc04054]
    100387132
Pattern recognition receptors [BR:cjc04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   100387132
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_6 LRR_4 LRR_8
Motif
Other DBs
NCBI-GeneID: 100387132
NCBI-ProteinID: XP_017824979
Position
Un
AA seq 152 aa AA seqDB search
LHDSNISDRGICKLIEHALHCEPLQKLDLFNNKLTDGCAHSMAKLLACKQNFLALRLGNN
HITAAGAQVLAEGLRSNTSLQFLGFWGNRVGDEGAQALAEALSDHQSLRWLSLVGNNIGS
VGAQALALMLAKNVMLEDLWNSCVGRQRWMID
NT seq 460 nt NT seq  +upstreamnt  +downstreamnt
tttgcacgatagcaatatctcagaccgaggcatctgcaagctcattgaacatgctcttca
ctgcgagccactgcagaagttagatctgttcaacaacaaattgaccgacggctgtgcaca
ctccatggcgaagctccttgcatgcaagcagaactttttggcattgaggctggggaataa
ccacatcaccgccgcgggagcccaagtgctggctgaggggctgcgaagcaacacctcctt
gcagttcctggggttctgggggaacagagtgggtgatgagggggcccaggccctggctga
agccttgagtgatcaccagagcttgaggtggctcagcctggtggggaacaacattggcag
tgtgggtgctcaagccttagcactgatgctggcaaagaacgtcatgctagaagacctctg
gaacagttgtgtgggtagacaaaggtggatgattgattga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100414962Help
Entry
100414962         CDS       T03264                                 

Gene name
NOD2
Definition
(RefSeq) nucleotide binding oligomerization domain containing 2
  KO
K10165  nucleotide-binding oligomerization domain-containing protein 2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04621  NOD-like receptor signaling pathway
cjc04668  TNF signaling pathway
cjc05152  Tuberculosis
cjc05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100414962 (NOD2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100414962 (NOD2)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    100414962 (NOD2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100414962 (NOD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:cjc04054]
    100414962 (NOD2)
Pattern recognition receptors [BR:cjc04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   100414962 (NOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Adap_comp_sub NACHT CARD GRIM-19 NLRC4_HD2 PHM7_cyt LRR_6 NOD2_WH RSN1_TM AAA_22 AAA_16 LRR_8 AAA_29 AAA_25 AAA_30 NB-ARC ABC_tran
Motif
Other DBs
NCBI-GeneID: 100414962
NCBI-ProteinID: XP_017822242
Position
20
AA seq 2007 aa AA seqDB search
MMGSLDWIKSEARTKANLGFAGADLPWPSNHPASGFQRSPALMLFSSPGCEMCSQEAFQA
QRSQLVELLVSGSLEGFESVLDWLLSWEVLSWEDYEGFHILGQPLSHLARRLLDTVWNKG
TWACQKLITAVQEVQADSRTPKLHGCWHPYSLHPAQDLQSHRPAIVRRLHSHVEGVLDLA
CERGFVSQYECDEIRLPIFTPSQRARRLLDLATVKANGLAAFLLQHVQELPVPLALPLEA
ATCKKYMAKLRTTVSAQSRFLSTYDGAETLCLEDIYTENVLEVWADVGVAGLPQKSPATL
GLEELFSTPGHLSDDADTVLVVGEAGSGKSTLLQRLHLLWAAGRDFQEFLFVFPFSCRQL
QCVVKPLSVQMLLFEHCCWPDVDQQDIFQFLLDHPDRVLLTFDGFDEFKFRFSDRERHCS
PTDPTSVQTLLFNLLQVNLLKNARKVVTSRPASMSAFLRKYIHTEFILKGFSKEGIELYL
RKRHHDPGVADRLIRLLQASSALSGLCHLPVFSWMVSKCHQELLLGRGGSPKTTTDMYLL
ILQHFLLHAIPPDSACHILGPSLLLGCLPTLLRLGRLALWGLGMCCYVFSAQQLQAAQVS
PDDISLGFLVCAKGVMPESTVPLEFLHITFQCFFAAFYLALSADVPPALLRHLFNCGRPG
NSPMARLLPMLCIQGSRGKDGSVAALLQKTEPHNLQITAAFLAGLLSWEHWGLLAECQAS
KKALLQRQACARWCLARSLRKHFHSIPPAAPGEAKSMHAMPRFIWLLRSLYEMQDERLAR
KAVRGLNVGHLKLTFCSVGPTECAALAFVLRHLQRPVALQLDYNSVGDIGVEQLLPCLGV
CKALYMLTLSIRTLFYGYWKKIKWNHECRCLQIEDFEAHIALMPLFQAEMDQRILHMLQE
NLEEESIIVKDVPGWKVGESVFNTTRWVPPLLRELYGLCFLEEAVFANHGFMIPGVEKRE
QVLLQEEGSSTAIASYLLGPSAATMSTSAVFILDVKGKPLISHNCKGNVPMSKIDYFMPL
LVQQDEEGSLTLRLSYGKVHFLWIKHSNLYLVATTLKNANASLTTDIKILQEYITQQSNK
LEMESVNLLVNANDSVLLSEIIGTINLKVLLSGMPELRLGLNDHVLFELTGYSKNKLLEL
EDMKFHQCVQLSCFDNNRTISFILPDDDFELMSYRLSTQVKPLIWIEFVIGKFSHSHVEI
LVKTKGQFKKQSVANGVEISVPSIKSFLGSKECLMRAHFGLPSMEKEEVEGRPPIRVKFE
ILYFTISGIQVRYMKIIEKSGHQALPWLLQEFLRPHPEAIINLLEHGLTALLKVRQHHTL
EGFLQHIIGLLVVMSVLSVGIVLPVNFSGGLLENNAYSFGRTTIANLKSGNNLLWLHTSF
TFLNTKMHYKKDDLVKWTPFINEISKYAESEKIKKHFEEAYPNCTVLKAHPSYSVARLMF
LNAERKKAKQGKLYFTNLQSKENMPTMINPKPCGHLCGCVDFDMCKCQSCTCRGEPCSSS
CSESLHISNWTVSYAPDPQNTYWEHLSIQGFIWWLCCLVINVLFILLFFLTTPAIIITTM
DKFNVTKPVEYLSNPIITQFFPTLLLCFNTVPNYDNDAWSMDDISEVQVELTEVHTNSCD
NISQFSVDSIISQESKEPVFIAAGDIHQSLSEQLAHTPTAFKQDPEDPSAVALKEPWQNK
VGQIKEGSPYGHLPNCLDGDMFNYYKMLMLQGLIAAQKHMDKVVQIMEIMQQGSQLPCFH
GSSAIRNLKERFHMSITEKELQLLVEQMVDGSMHSITTKLYDGFQYLTNGIMVLKGSFHR
PSSYSILGHRKQGRVGSRYLGLVPVVGHWPCCCPTLPLPETDPWPKLPLLFMSKTHIRHS
LTPCVDSFGLFRFWGNRVGDEGAQALAEALSDHQSLRWLSLVGNNIGSVGAQGLALMLAK
NVMLEELCLEENHLQDEGVCSLAEGLKRNSSLKILKLSKNCITYLGAEALLQALERNDTI
LEVWLRGNTFSLEEVDKLSCRDTRLLL
NT seq 6024 nt NT seq  +upstreamnt  +downstreamnt
atgatggggagcttggattggataaagtctgaggctagaaccaaggccaacttgggtttt
gctggggctgacttgccttggccttccaaccacccggcgtctggctttcagagaagtccc
gcactgatgttgttttcctccccaggttgtgaaatgtgctcgcaggaggcttttcaggca
cagaggagccagctggtggagcttttggtctcgggatccctggagggcttcgagagcgtc
ctggactggctgctctcctgggaagtcctctcctgggaagactacgagggcttccacatc
ctgggccagcctctctcccacttggccaggcgcctcctggatactgtctggaataagggt
acttgggcctgtcagaaactcatcacagctgtccaggaagtgcaggctgacagccggacc
cccaagctgcatggctgctggcacccctactcactccacccagcccaagacctgcagagt
caccggccagccattgtcaggaggctccacagccatgtggagggcgtgctggacctggca
tgtgagcggggtttcgtcagccagtatgaatgtgatgaaatcaggctgccgatcttcaca
ccgtcccagagggccagaaggctgctcgatcttgccacagtgaaggcgaatggattggct
gccttccttctacagcatgttcaagaattaccagtcccgttggccctacctttggaagct
gccacatgcaagaagtacatggccaagctgaggaccacagtgtctgctcagtcccgcttc
ctcagtacctatgacggggcagagacgctctgcctggaggacatatacacagagaatgtc
ctggaggtctgggcggatgtgggcgtggctggactcccgcagaagagcccggccactctg
gggctggaggagctcttcagcacccctggccacctcagtgacgatgcagacactgtgctg
gtagtgggcgaggcgggcagcggcaagagcacgctcctgcagcggctgcacttgctgtgg
gctgctgggcgagacttccaggaatttctctttgtcttcccattcagctgccggcagctg
cagtgcgtggtcaaaccactctctgtgcagatgctactctttgagcactgctgttggccc
gacgttgatcaacaggacatctttcagtttctccttgaccaccctgaccgtgtcctgcta
acctttgatggctttgacgagttcaagttcaggttctcggatcgcgagcgtcactgctcc
ccgacggaccccacctctgtccagactctgctctttaaccttctgcaggtcaacctgctg
aagaatgcccgcaaggtggtgaccagccgtcctgcttccatgtcggcgttcctcagaaag
tacatccacaccgagttcatcctcaagggcttctccaaagagggcatcgagctgtacttg
aggaagcgccatcatgatcctggagtggcagaccgcctcattcgcctgctccaagcgtcc
tcagccctgagtggtttgtgccaccttcctgtgttctcatggatggtgtccaaatgccac
caggaactgttgctagggcgggggggatccccgaagaccactacagatatgtacctgctg
atcctgcagcattttctgctgcatgccatccccccagactcagcctgccacattctggga
cccagtctccttctgggctgcctccccacacttctgcgcctcggcagacttgctctctgg
ggcctgggcatgtgctgctatgtgttctcagcccagcagctccaggcagcacaggtcagt
cctgatgacatttctcttggcttcctggtatgtgccaaaggtgtcatgccagagagtaca
gtgcctctggaattcctgcacatcactttccagtgcttctttgctgcgttctacctggca
ctcagtgctgatgtgccgccagccttgctcagacacctcttcaattgtggcaggccaggc
aactcaccaatggccaggctcctgcccatgttgtgcatccagggctcgcgggggaaggat
ggcagcgtggcagctttgctgcagaagactgagccgcacaaccttcagatcacggcagcc
ttcctggcggggctgttgtcctgggagcactggggcctgctggccgagtgccaggcatcc
aagaaggccctgctccagcgccaggcctgtgcccgctggtgtctggcccgcagcctccgc
aagcacttccactccatcccgccagccgcgccaggtgaggccaagagcatgcacgccatg
cccaggttcatctggctcctccggagcctatatgagatgcaggatgagcggctggcacgg
aaggctgtacgtggcctgaatgtcgggcacctcaagttgacattttgcagcgtgggcccc
actgagtgtgctgctctggccttcgtgctgcggcacctccagcggcccgtggccctgcag
ctggactacaactctgtgggtgacattggcgtggagcagctgctgccttgccttggtgtc
tgcaaggctctgtacatgctgaccctgagcatcaggaccctgttctatgggtactggaaa
aaaattaagtggaatcatgaatgcaggtgcctacagatcgaggactttgaggcccacatc
gcactgatgccactgttccaggctgaaatggaccagaggatcctgcacatgcttcaggag
aatctggaggaggagtccatcatcgtgaaggatgtgcccggctggaaggtcggggagtct
gtgttcaacacaactcgctgggtgccccccttgctcagggagctgtatggactgtgcttc
ctggaggaggctgtctttgccaaccacggctttatgatacctggggtggagaaaagggag
caggtgcttctgcaggaagaaggaagcagcaccgccattgcctcctacctcctaggtccc
tcggctgccaccatgtccacctcagctgtcttcattctcgatgtcaagggcaagcccctg
atcagccacaactgcaagggcaatgtgcccatgagcaagattgattacttcatgcctctg
ctggtgcagcaggatgaggagggctccctcaccctaaggctgagctatggcaaggtccac
ttcctatggatcaaacacagcaacctctacctggtggccaccacattgaagaatgccaat
gcctcactgaccaccgacatcaagatcctgcaggagtacatcactcagcagagcaacaag
ctggagatggagtctgtcaacctgctggtcaatgccaatgacagtgtcctgctgagcgag
atcattggtaccatcaacctcaaagtgcttctgtcaggaatgcctgagctgcggctgggc
ctcaatgaccatgtgctctttgagctcactggctacagcaagaacaaattgttagagcta
gaggatatgaaattccaccagtgtgtgcagctctcatgctttgacaacaaccgcaccatc
tctttcatcctgcctgatgatgactttgagctcatgtcctaccgcctcagcacccaggtg
aagccactgatctggattgagtttgtcattgggaagttctcccacagccatgtggagatc
ttagtcaagaccaaggggcagtttaagaaacagtcagtggccaatggtgtggagatatct
gtgcctagtattaagtctttcctggggagcaaggagtgcttgatgcgagcccactttggc
ctccccagcatggagaaggaggaggtggagggccggccccctatccgggtcaagtttgag
atcctctacttcaccatctctgggatccaggtccgatacatgaagatcattgagaaaagt
ggtcaccaggccctgccctggctgctgcaagaattcctgcgtccccacccagaagctatc
attaatttgctggaacatggcctgacagctcttctcaaagtccggcagcaccacactctt
gaaggcttcttgcagcacatcattgggctgctggtggtcatgagtgtcctctccgtaggc
atcgtgcttcctgtcaacttctcagggggcctgctggagaacaatgcctacagctttggg
agaaccaccatagccaacttgaaatcaggaaacaacctgctatggctgcacacctccttc
accttcctaaacaccaagatgcactacaagaaggacgatctggtgaagtggacccccttc
atcaatgaaatctccaaatatgcagagtcagaaaagatcaagaagcattttgaggaggcc
taccccaactgcacagttctcaaagcccacccgagttacagtgtggctcgcctcatgttc
ctcaatgcagagagaaagaaggccaagcagggaaagctgtatttcacaaacctccagagc
aaggagaacatgcccaccatgatcaaccccaagccctgcggccacctctgcggctgcgtg
gacttcgacatgtgtaagtgccagagctgcacctgccgcggggagccatgctcctcatcc
tgcagcgagtccctgcacatctccaactggactgtgtcctatgcccctgacccccagaac
acctactgggagcacctctccatccaaggcttcatctggtggctgtgctgcctggtcatc
aatgtcctattcattctcctcttcttcctcaccactccagccatcatcatcaccaccatg
gacaagttcaatgtcaccaagcctgtggagtacctcagcaatcccatcatcacccagttc
ttccccaccctgctactgtgcttcaacactgtacccaactatgacaatgatgcctggtca
atggatgacataagtgaggtgcaagtggagctcactgaagtgcacaccaacagctgtgac
aacatctcccagttctctgtggacagcatcatcagccaggagagcaaagagcctgtgttc
attgcagcaggggacatccaccagagcctttcagaacagctagctcacaccccaacagcc
ttcaaacaagacccagaagatccttctgcagttgctctcaaagagccctggcagaataaa
gtagggcagatcaaagagggctccccctacgggcatctccccaattgcctggatggtgac
atgttcaactactataagatgctgatgctgcaagggctgattgctgctcagaaacacatg
gacaaggtggtgcagatcatggagatcatgcagcaaggttctcagcttccttgcttccat
ggttccagcgccattcgaaacctcaaagagagattccacatgagcataactgagaaggag
ctgcagctgctggtggagcagatggtggatggcagtatgcactctatcaccaccaaactc
tatgacggcttccagtacctcaccaatggcatcatggttctgaagggttctttccacagg
ccatcctcttattccattctggggcacaggaagcagggaagagtaggttctcggtactta
ggacttgttcctgtggttggccactggccatgctgctgcccaactctacccctcccagag
accgacccctggcccaagctccccttgctgttcatgtctaaaacacatatcaggcactca
ctgacaccgtgtgttgattcttttggccttttcaggttctggggcaacagagtgggtgat
gagggggcccaggccctggctgaagccttgagtgatcaccagagcttgaggtggctcagc
ctggtggggaacaacattggcagtgtgggtgctcaaggcttagcactgatgctggcaaag
aacgtcatgctagaagaactctgcctggaggagaaccatctccaggatgaaggtgtatgt
tctctcgcagaaggactgaaaagaaattcaagtttgaaaatcctgaagttgtccaaaaac
tgcatcacctacctaggggcagaagccctcctgcaggcccttgaaaggaatgacaccatc
ttggaagtctggctccgagggaacactttctctctagaggaggttgacaagctcagctgc
agggacaccagactcttgctttga

DBGET integrated database retrieval system