KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100387176Help
Entry
100387176         CDS       T03264                                 

Gene name
EDAR
Definition
(RefSeq) ectodysplasin A receptor
  KO
K05162  tumor necrosis factor receptor superfamily member EDAR
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04064  NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100387176 (EDAR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100387176 (EDAR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:cjc04050]
    100387176 (EDAR)
Cytokine receptors [BR:cjc04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100387176 (EDAR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4501 TNFR_c6
Motif
Other DBs
NCBI-GeneID: 100387176
NCBI-ProteinID: XP_017819624
Ensembl: ENSCJAG00000001257
Position
14
AA seq 428 aa AA seqDB search
MCSARAEYSNCGENEYYNQTTGLCQECPLCGPGEEPYLSCGYGAKDEDYGCVPCPAEKFS
KGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGYYMLENRPRNIYGMVCYSCLL
APPNTKECVGATSGASANFPGTSSSSTLSPFQHAHKELSGQGHLATALIIAMSTIFIMAI
AIVLIIMFYILKTKPSAPACCTSHPGKSVEAPVSKDEEKKEAPDNVVMFSEKDEFEKLTA
TPAKPTKSENDASSENEQLLSRSVDSDEEPAPDKQGSPELCLLSLVHLAREKSATSNKSA
GIQSRRKKILDVYANVCGVVEGLSPTELPFDCLEKTSRMLSSTYNSEKAVVKTWRHLAES
FGLKRDEIGGMTDGMQLFDRISTAGYSIPELLTKLVQIERLDAVESLCADILEWVGVVPP
ASQPHAAS
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtgctcggcgcgagcagaatactcaaactgcggcgagaacgagtactacaaccagact
acggggctgtgccaggagtgccccctgtgtgggccgggggaggagccctacctgtcctgt
ggctatggcgccaaagatgaggactacggctgcgtcccctgcccagcagagaagttttcc
aaaggaggctaccagatatgcaggcgccacaaagactgtgagggcttcttccgggccact
gtgctgacaccgggggacatggaaaacgacgctgagtgtggcccttgtctccctggctac
tacatgctggagaacagacccaggaacatctacggcatggtctgctactcctgcctcctg
gcgccccccaacaccaaggaatgtgtgggagccacttcaggagcttctgccaacttccct
ggcacctcgagcagcagcacgctgtctcccttccagcatgcccataaagagctctcaggc
caaggacacctggccactgccctgatcattgcgatgtccaccatcttcatcatggcgatc
gccatcgtcctcatcatcatgttctacatcctgaagacaaagccctctgccccagcctgc
tgcaccagccacccagggaagagtgtggaggccccagtgagcaaggatgaggagaagaaa
gaggccccagacaatgtggtgatgttctctgagaaggatgaatttgagaagttgacagca
actccagcaaagcccaccaagagcgagaacgatgcctcgtcagagaatgagcagttgctg
agccggagcgtggacagtgatgaggagcccgcccctgacaagcagggctccccagagctg
tgcctgctgtcgctggttcacctggccagggagaagtctgccaccagcaacaagtcagcc
gggattcaaagccggaggaaaaagatcctggatgtgtatgccaatgtctgtggagtcgta
gaaggtctcagccccacagagctgccatttgattgcctcgagaagactagccgaatgctc
agctccacgtacaactctgagaaggctgttgtgaaaacgtggcgccacctcgctgagagc
ttcggcctgaagagggatgagattgggggcatgacagacggcatgcagctctttgaccgc
atcagcacagcaggttatagcatccctgagctgctcacaaaactggtacagattgagcgg
ctggatgctgtggagtccttgtgtgcagacatactggagtgggtgggggttgtgccccct
gcctcccagccacatgctgcatcctga

DBGET integrated database retrieval system