KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100387373Help
Entry
100387373         CDS       T03264                                 

Gene name
CCL20
Definition
(RefSeq) C-C motif chemokine ligand 20
  KO
K14625  C-C motif chemokine 20
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04062  Chemokine signaling pathway
cjc04657  IL-17 signaling pathway
cjc04668  TNF signaling pathway
cjc05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100387373 (CCL20)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100387373 (CCL20)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    100387373 (CCL20)
   04062 Chemokine signaling pathway
    100387373 (CCL20)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    100387373 (CCL20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100387373 (CCL20)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Chemokines
   100387373 (CCL20)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 100387373
NCBI-ProteinID: XP_002749909
Ensembl: ENSCJAG00000013048
UniProt: F7FKP5
Position
6
AA seq 96 aa AA seqDB search
MCCSKSLLLASLMLMLLLHLSGKSEAASNFDCCLRYTEHILHPKIIVGFTQQLANEACDI
NAIIFHTKRKLSVCANPRQIWVKQAVRIISQRVKKM
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atgtgctgtagcaagagtttgctcctggcttctttgatgttaatgctgctactccacctc
agtggcaaatcagaagcagcaagcaactttgactgctgtctccgatacacagaacacatc
cttcatcctaaaatcattgtgggtttcacacagcagctggccaatgaagcttgtgacatc
aatgctatcatctttcacacaaagagaaaattatctgtgtgtgcaaatccaaggcagatc
tgggtgaaacaagctgtgcgtatcatcagccaaagagtcaagaagatgtaa

DBGET integrated database retrieval system