KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100387401Help
Entry
100387401         CDS       T03264                                 

Gene name
TRAF3
Definition
(RefSeq) TNF receptor associated factor 3
  KO
K03174  TNF receptor-associated factor 3
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04064  NF-kappa B signaling pathway
cjc04620  Toll-like receptor signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04622  RIG-I-like receptor signaling pathway
cjc04657  IL-17 signaling pathway
cjc04668  TNF signaling pathway
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05164  Influenza A
cjc05165  Human papillomavirus infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05200  Pathways in cancer
cjc05203  Viral carcinogenesis
cjc05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100387401 (TRAF3)
   04668 TNF signaling pathway
    100387401 (TRAF3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100387401 (TRAF3)
   04621 NOD-like receptor signaling pathway
    100387401 (TRAF3)
   04622 RIG-I-like receptor signaling pathway
    100387401 (TRAF3)
   04657 IL-17 signaling pathway
    100387401 (TRAF3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100387401 (TRAF3)
   05203 Viral carcinogenesis
    100387401 (TRAF3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100387401 (TRAF3)
  09172 Infectious disease: viral
   05162 Measles
    100387401 (TRAF3)
   05164 Influenza A
    100387401 (TRAF3)
   05161 Hepatitis B
    100387401 (TRAF3)
   05160 Hepatitis C
    100387401 (TRAF3)
   05168 Herpes simplex virus 1 infection
    100387401 (TRAF3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100387401 (TRAF3)
   05169 Epstein-Barr virus infection
    100387401 (TRAF3)
   05165 Human papillomavirus infection
    100387401 (TRAF3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-TRAF ATG16 MPS2 zf-C3HC4 Spc7 Tropomyosin_1 Spc29 zf-C3HC4_2 FliJ T3SSipB KxDL DUF1664 BLOC1_2 SPATA24 DUF3450 LMBR1 ADIP
Motif
Other DBs
NCBI-GeneID: 100387401
NCBI-ProteinID: XP_017832836
Ensembl: ENSCJAG00000009729
UniProt: F7B686
Position
10
AA seq 568 aa AA seqDB search
MESSKKMDSPGTLQTNPPLKLHTDRSAGTPIFVPEQGGYKEKFVKAVEDKYKCEKCHLVL
CSPKQTECGHRFCESCMAALLSSSSPKCTACQESIIKDKVFKDNCCKREILALQIYCRNE
SRGCAEQLTLGHLLVHLKNDCQFEELPCVRTDCKEKVLRKDLRDHVEKACKYREATCSHC
KSQVPMITLQKHEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCV
FQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEI
EIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNR
VTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIW
KIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRG
EYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQ
TVLENGTYIKDDTIFIKVIVDTSDLPDP
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atggagtcaagtaagaagatggactccccgggcacactgcagaccaacccgcccctgaag
ctgcacactgaccgcagtgctgggacgccgatttttgtccctgagcaaggaggttacaag
gagaagtttgtgaaggccgtggaggacaagtacaagtgtgagaagtgccacctggtgctg
tgcagcccgaagcagactgagtgtggccaccgcttctgcgagagctgcatggccgctctg
ctgagctcttcaagtccaaaatgtaccgcgtgtcaagagagcatcattaaagataaggtg
tttaaggataattgttgcaagagagaaatccttgctcttcagatctactgtcggaatgag
agccgaggttgtgcagagcagctgacgctggggcatctgttggtgcatttaaaaaatgat
tgccagtttgaagaacttccatgtgtgcgtactgactgcaaagagaaggtcttgaggaaa
gacctgcgagaccacgtggagaaggcgtgtaaataccgggaagccacgtgcagccactgc
aagagtcaggttccgatgatcacactgcagaaacatgaagacacggactgtccctgcgtg
gtggtgtcctgccctcacaagtgcagcgtccagactctcctgaggagcgagttgagtgca
cacttgtcagagtgtgtcaatgcccccagcacctgtagttttaagcgctatggctgcgtt
tttcaggggacaaaccagcagatcaaggcccacgaggccagctccgccgtgcagcacgtc
aacctgctgaaggagtggagcaactcgctcgagaagaaggtttccttgctgcagaatgaa
agtgtagaaaaaaacaagagcatacaaagtttgcacaatcagatatgtagctttgaaatt
gaaattgagagacaaaaggaaatgcttcgaaataatgaatccaaaatccttcatttacag
cgagtgatagacagccaagcagagaaactgaaggagctcgacaaggagatccggcccttc
cggcagaattgggaggaagcagacagcatgaagagcagcgtggagtccctccagaaccgc
gtgaccgagttggagagcgtggacaagagcgcagggcaggtggctcggaacacaggcctg
ctggagtcgcagctgagccggcacgaccagatgctgagcgtgcacgacatccgcctggcc
gacatggacctgcgcttccaggtcctggagaccgccagctacaacggcgtgctcatctgg
aagattcgcgactacaagaggcggaagcaggaggccgtcatggggaagaccctgtccctc
tacagccagcctttctacactggctactttggttataagatgtgtgccagggtctacctg
aacggggacgggatgggaaaggggacgcacctgtctctgttttttgtcatcatgcgtgga
gagtatgatgccctgcttccttggccgtttaagcagaaagtgacactcatgttgatggat
caggggtcctctcggcgtcacctgggagacgctttcaagcctgaccccaacagcagcagc
ttcaagaagcccaccggagagatgaatatcgcctctggctgcccggtctttgtggcccaa
actgttctagaaaatgggacatatattaaagatgatacaatttttattaaagtcatagtg
gatacttcggatctgcccgatccctga

DBGET integrated database retrieval system