KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100387448Help
Entry
100387448         CDS       T03264                                 

Gene name
MMP2
Definition
(RefSeq) matrix metallopeptidase 2
  KO
K01398  matrix metalloproteinase-2 (gelatinase A) [EC:3.4.24.24]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01522  Endocrine resistance
cjc04670  Leukocyte transendothelial migration
cjc04912  GnRH signaling pathway
cjc04915  Estrogen signaling pathway
cjc04926  Relaxin signaling pathway
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05219  Bladder cancer
cjc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100387448 (MMP2)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100387448 (MMP2)
   04915 Estrogen signaling pathway
    100387448 (MMP2)
   04926 Relaxin signaling pathway
    100387448 (MMP2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100387448 (MMP2)
   05205 Proteoglycans in cancer
    100387448 (MMP2)
  09162 Cancer: specific types
   05219 Bladder cancer
    100387448 (MMP2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100387448 (MMP2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100387448 (MMP2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100387448 (MMP2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cjc01002]
    100387448 (MMP2)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.24  gelatinase A
     100387448 (MMP2)
Peptidases [BR:cjc01002]
 Metallo Peptidases
  Family M10
   100387448 (MMP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 fn2 Hemopexin PG_binding_1 Reprolysin_3 Reprolysin_4 Reprolysin_5 Peptidase_M66
Motif
Other DBs
NCBI-GeneID: 100387448
NCBI-ProteinID: XP_002761063
Ensembl: ENSCJAG00000012929
UniProt: F7G084
Position
20
AA seq 660 aa AA seqDB search
MEALKAQGALAGPLRTLCLLGCLLGHAAAPPSPIIKFPGDVAPKTDKELAVQYLNTFYGC
PKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPNKPKWD
KNQITYRILGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGD
GYPFDGKDGLLAHAFSPSPGIGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFS
GKEYNSCTDIGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGT
SYNSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKY
ESCTSAGRSDGKMWCATTASYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSKDPGAL
MAPIYTYTKNFRLSQDDIKGIQELYGVSPDIDLGTGPTPTLGPVTPEICTQDIVFDGIAQ
IRGEIFFFKDRFIWRTVTPRDKPTGPLLVATFWPDLPEKIDAVYEAPQEEKTVFFAGNEY
WIYSASTLERGYPKPLTSLGLPPDVQKVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDP
GFPKLIADAWNAIPDNLDAVVDLQGSGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgctaaaggcccagggcgcgctcgcgggtcccctgaggacgctctgcctcctg
ggctgcctgctgggccacgccgccgccccgccgtcgcccatcatcaagttccctggcgat
gtcgccccaaaaacggacaaagagttggcagtgcaatacctgaacaccttctacggctgc
cccaaagagagttgcaacctgttcgtgctgaaggacacgctgaagaagatgcagaagttc
tttggactgccccagacaggcgatcttgaccagaacaccattgagaccatgcggaagccg
cgctgcggcaacccagatgtggccaactacaacttcttccccaacaagcccaagtgggac
aagaaccagatcacatacaggatccttggctacacacccgatctggacccagagacggtg
gatgatgccttcgctcgtgccttccaagtctggagtgatgtgacccccctgcggttttca
cgaatccatgatggagaggcagacatcatgatcaacttcggccgctgggaacatggcgac
ggatacccctttgatggtaaggatggactcctggctcatgctttctccccaagccctggt
attgggggagactcccactttgatgacgatgagctgtggaccttgggagaagggcaagtg
gtccgtgtgaagtacgggaatgccgatggggagtactgcaagttccccttcctgttcagt
ggcaaggagtacaacagctgcactgacataggccgcagcgacggcttcctctggtgctcc
accacctacaactttgagaaggacggcaagtacggcttctgtccccacgaagccctgttc
accatgggcggcaacgctgaaggacagccctgcaagttcccattccgtttccagggcaca
tcgtataacagctgcaccactgagggccgtacggatggctaccgctggtgcggcaccact
gaggactacgatcgtgacaagaagtatggcttctgccctgagactgccatgtccactgtt
ggtgggaactcagaaggtgccccctgtgtcttccccttcaccttcctgggcaataagtat
gagagctgcaccagcgccggccgcagtgatggaaagatgtggtgtgcaaccacagccagc
tacgacgacgaccgcaagtggggcttctgccccgaccaagggtacagcctgttccttgtg
gcagcccatgagtttggccacgccatggggctggagcactccaaggaccctggagctctg
atggcgcccatttacacctacaccaagaacttccgcctgtcccaggatgacatcaagggc
attcaggagctctatggggtctctcctgacattgaccttggcaccggccccacccccacg
ctgggacctgtcactcctgagatctgcacacaggacattgtttttgatggcattgctcag
atccgtggtgagatcttcttcttcaaggaccgattcatttggcggactgtgacaccgcgt
gacaagcccacggggcccctgctggtggccacattctggcctgacctcccggaaaagatt
gatgcggtatacgaggccccacaggaagagaaaactgtgttctttgcagggaatgaatac
tggatctactcagccagcaccctggagcgagggtatcccaagccactgaccagcttggga
ctgccccctgatgtccagaaagtggatgccgcctttaactggagcaagaacaagaagaca
tacatctttgctggagacaaattctggagatacaatgaagtgaagaagaaaatggatcct
ggcttccccaagctcatcgcggatgcctggaatgccattcccgataacctagatgccgtc
gtggacctgcagggtagcggtcacagctacttcttcaagggtgcctattacctgaagctg
gagaaccaaagtctgaagagcgtgaagtttggaagcatcaaatccgactggctaggctgc
tga

DBGET integrated database retrieval system