KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100387484Help
Entry
100387484         CDS       T03264                                 

Definition
(RefSeq) 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1
  KO
K00070  3beta-hydroxy-Delta5-steroid dehydrogenase / steroid Delta-isomerase [EC:1.1.1.145 5.3.3.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00140  Steroid hormone biosynthesis
cjc01100  Metabolic pathways
cjc04913  Ovarian steroidogenesis
cjc04925  Aldosterone synthesis and secretion
cjc04927  Cortisol synthesis and secretion
cjc04934  Cushing syndrome
Module
cjc_M00107  Steroid hormone biosynthesis, cholesterol => prognenolone => progesterone
cjc_M00110  C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    100387484
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    100387484
   04925 Aldosterone synthesis and secretion
    100387484
   04927 Cortisol synthesis and secretion
    100387484
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100387484
Enzymes [BR:cjc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.145  3beta-hydroxy-Delta5-steroid dehydrogenase
     100387484
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.1  steroid Delta-isomerase
     100387484
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3Beta_HSD Epimerase NAD_binding_4 GDP_Man_Dehyd Polysacc_synt_2 NAD_binding_10 RmlD_sub_bind NmrA KR Ldh_1_N
Motif
Other DBs
NCBI-GeneID: 100387484
NCBI-ProteinID: XP_017824488
Position
7
AA seq 373 aa AA seqDB search
MTSWSCLVTGAGGFLGQRIVRLLVEEKELKEIRVLDKAFRPELREEFSKLQSKTKLTMLE
GDILDEPFLKRACQDVTVVIHTASIIDVLGAIHRESIMNVNVKGTQLLLEACVHASVPVF
IYTSSVEVAGPSSYKEVIQNGHEDQPLESTLSAPYPHSKRLAEKAVLAANGWTLKNGGIL
YTCALRPMYIYGEGSPFLSATVNEALHNRGILPSTGKFSTVNPVYVGNVAWAHILALRAL
RDPRKAPSVRGQFYYISDDTPHQSYDGLNYTLSKEFGLYLNSSWSLPLFLMYWIAFLLEV
VSFLLSPIYTYRPPFNRHTVTLSNSTYTFSYKKAQRDLAYKPLYSWEEARQKTMEWVGSL
VDRHKETLKPKTQ
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgacgagctggagctgccttgtgacaggagcaggagggtttctgggtcagaggattgtc
cgcctgctggtggaggagaaggagctgaaggagatcagggtcttggacaaggccttcaga
ccggaactcagggaggaattttctaagctccagagcaagaccaagctgacgatgctggaa
ggagacattctggatgagccattcctgaagagagcctgccaggacgtcacggttgtcatc
cacacggcctctatcattgatgtcttgggtgccattcacagagaatccatcatgaacgtc
aacgtgaaaggtacccagctcctgttggaagcctgtgtccacgctagtgtgccagtcttc
atctacaccagcagcgtagaggtggccgggcccagctcctacaaggaagtcatccagaac
ggtcatgaagatcagcctctggaaagcacattgtctgctccctatccacacagcaaacgg
cttgctgagaaggctgtgctggcggctaatgggtggactctgaaaaacggtggcatcttg
tacacttgtgccttaagacccatgtacatctatggggaaggaagcccattcctttctgcc
actgtaaatgaagccctccacaacagggggatcctgccaagtactggcaagttctccaca
gtcaacccagtatatgttggcaacgtggcctgggcccacattctggccttgagggccctg
cgggaccccaggaaggccccgagtgtccgaggacagttctattacatctcagatgacaca
cctcaccaaagctatgatggccttaattacaccctgagcaaagagttcggcctctacctt
aattccagttggagccttcctctattcctgatgtactggattgccttcctgctggaagta
gtgagcttcctgctcagcccaatttacacctatcgaccccccttcaaccggcacacagtg
acgctgtcaaatagcacgtacaccttctcttacaagaaggctcagcgagatctggcatac
aagccgctctacagctgggaggaagccaggcagaaaaccatggagtgggttggttccctt
gtggaccggcacaaggagacgctgaagcccaagactcagtga

DBGET integrated database retrieval system