KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100387508Help
Entry
100387508         CDS       T03264                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01522  Endocrine resistance
cjc04012  ErbB signaling pathway
cjc04066  HIF-1 signaling pathway
cjc04068  FoxO signaling pathway
cjc04110  Cell cycle
cjc04151  PI3K-Akt signaling pathway
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc04934  Cushing syndrome
cjc05162  Measles
cjc05165  Human papillomavirus infection
cjc05169  Epstein-Barr virus infection
cjc05200  Pathways in cancer
cjc05202  Transcriptional misregulation in cancer
cjc05203  Viral carcinogenesis
cjc05206  MicroRNAs in cancer
cjc05215  Prostate cancer
cjc05220  Chronic myeloid leukemia
cjc05222  Small cell lung cancer
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100387508 (CDKN1B)
   04066 HIF-1 signaling pathway
    100387508 (CDKN1B)
   04068 FoxO signaling pathway
    100387508 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    100387508 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100387508 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100387508 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    100387508 (CDKN1B)
   05206 MicroRNAs in cancer
    100387508 (CDKN1B)
   05203 Viral carcinogenesis
    100387508 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    100387508 (CDKN1B)
   05220 Chronic myeloid leukemia
    100387508 (CDKN1B)
   05215 Prostate cancer
    100387508 (CDKN1B)
   05222 Small cell lung cancer
    100387508 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100387508 (CDKN1B)
   04934 Cushing syndrome
    100387508 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    100387508 (CDKN1B)
   05169 Epstein-Barr virus infection
    100387508 (CDKN1B)
   05165 Human papillomavirus infection
    100387508 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100387508 (CDKN1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CDI Multi-haem_cyto
Motif
Other DBs
NCBI-GeneID: 100387508
NCBI-ProteinID: XP_002752175
Ensembl: ENSCJAG00000021636
UniProt: F7IJ60
Position
9
AA seq 198 aa AA seqDB search
MSNVRMSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQLKW
NFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIG
APANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPAADDSSTQNKRANRTEENVSDGSPN
AGSVEQTPKKPGLRRRQT
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacgtgcgaatgtctaacgggagccccagcctggagcggatggacgccaggcag
gcggagcaccccaagccctcggcctgcaggaacctcttcggcccggtggaccacgaagag
ttaacccgggacttggagaagcactgcagagacatggaagaggcgagccagctcaagtgg
aatttcgattttcagaatcacaagccccttgagggcaagtacgagtggcaagaggtggag
aagggcagcttgcccgagttctactacagacccccgcgcccccccaaaggcgcctgcaag
gtgccggctcaggagagccaggatgtcagcgggagccgcccggcggcgcctttaattggg
gctccggctaactctgaggacacgcacttggtagacccaaagactgatccgtccgacagc
cagacggggttagcggagcagtgcgcaggaataaggaagcgacctgcagctgacgattct
tctactcaaaacaaaagagccaacagaacagaagaaaatgtttcagacggttccccgaat
gccggttctgtggagcagacgcccaagaagcctggcctcagaagacgtcagacgtaa

DBGET integrated database retrieval system