KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100387518Help
Entry
100387518         CDS       T03264                                 

Definition
(RefSeq) ferritin heavy chain
  KO
K00522  ferritin heavy chain [EC:1.16.3.2]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04216  Ferroptosis
cjc04217  Necroptosis
cjc04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    100387518
   04217 Necroptosis
    100387518
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    100387518
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100387518
Enzymes [BR:cjc01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.3  With oxygen as acceptor
    1.16.3.2  bacterial non-heme ferritin
     100387518
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100387518
  Exosomal proteins of bladder cancer cells
   100387518
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ferritin Rubrerythrin
Motif
Other DBs
NCBI-GeneID: 100387518
NCBI-ProteinID: XP_017832310
UniProt: A0A2R8P242
Position
10
AA seq 183 aa AA seqDB search
MTTASPSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQS
HEEREHAEKLMKLQNQRGGRIFLQDIKKPDHDDWESGLNAMECALHLEKNVNQSLLELHK
LATDKNDPHLCDFIETHYLNEQVKSIKELGDHVTNLRKMGAPQSGLAEYLFDKHTLGDSD
NES
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgactaccgcatcaccttcgcaggtgcgccagaactaccaccaggattcagaggccgcc
atcaaccgccaaatcaacctggagctctacgcctcctatgtttacctgtccatgtcttac
tactttgaccgagatgatgtggctttgaagaactttgccaagtactttcttcaccagtct
catgaggagagggaacatgccgagaaactgatgaagctgcagaaccaacgaggtggccgc
atcttcctccaggatatcaagaaaccagaccatgatgactgggagagcgggctgaatgcg
atggagtgtgcattacatttggaaaaaaatgtgaatcagtcactactggaactgcacaaa
ctggccactgacaaaaatgacccccatttgtgtgacttcattgagacgcattacctgaat
gagcaggtgaaatccatcaaagaattgggtgaccacgtgaccaacttgcgcaagatggga
gcaccccaatctggcttggcagaatatctctttgacaagcacaccctgggagacagtgat
aatgaaagctaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100387774Help
Entry
100387774         CDS       T03264                                 

Gene name
FTH1
Definition
(RefSeq) ferritin heavy chain 1
  KO
K00522  ferritin heavy chain [EC:1.16.3.2]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04216  Ferroptosis
cjc04217  Necroptosis
cjc04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    100387774 (FTH1)
   04217 Necroptosis
    100387774 (FTH1)
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    100387774 (FTH1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100387774 (FTH1)
Enzymes [BR:cjc01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.3  With oxygen as acceptor
    1.16.3.2  bacterial non-heme ferritin
     100387774 (FTH1)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100387774 (FTH1)
  Exosomal proteins of bladder cancer cells
   100387774 (FTH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ferritin Rubrerythrin
Motif
Other DBs
NCBI-GeneID: 100387774
NCBI-ProteinID: XP_009006559
Ensembl: ENSCJAG00000019089
UniProt: A0A2R8P242
Position
11
AA seq 183 aa AA seqDB search
MTTASPSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQS
HEEREHAEKLMKLQNQRGGRIFLQDIKKPDHDDWESGLNAMECALHLEKNVNQSLLELHK
LATDKNDPHLCDFIETHYLNEQVKSIKELGDHVTNLRKMGAPQSGLAEYLFDKHTLGDSD
NES
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgcatcaccttcgcaggtgcgccagaactaccaccaggattcagaggccgcc
atcaaccgccaaatcaacttggagctctacgcctcctatgtttacctgtccatgtcttac
tactttgaccgagatgatgtggctttgaagaactttgccaagtactttcttcaccagtct
catgaggagagggaacatgccgagaaactgatgaagctgcagaaccaacgaggtggccgc
atcttcctccaggatatcaagaaaccagaccatgatgactgggagagcgggctgaatgcg
atggagtgtgcattacatttggaaaaaaatgtgaatcagtcactactggaactgcacaaa
ctggccactgacaaaaatgacccccatttgtgtgacttcattgagacgcattacctgaat
gagcaggtgaaatccatcaaagaattgggtgaccacgtgaccaacttgcgcaagatggga
gcaccccaatctggcttggcagaatatctctttgacaagcacaccctgggagacagtgat
aatgaaagctaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100390971Help
Entry
100390971         CDS       T03264                                 

Gene name
FTL
Definition
(RefSeq) ferritin light chain
  KO
K13625  ferritin light chain
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04216  Ferroptosis
cjc04217  Necroptosis
cjc04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    100390971 (FTL)
   04217 Necroptosis
    100390971 (FTL)
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    100390971 (FTL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100390971 (FTL)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100390971 (FTL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ferritin ANAPC4
Motif
Other DBs
NCBI-GeneID: 100390971
NCBI-ProteinID: XP_008986606
Ensembl: ENSCJAG00000000250
UniProt: F7G1I6
Position
22
AA seq 175 aa AA seqDB search
MSSQIRQNYSTDVEAAVNHLVNVYLQASYTYLSLGYYFDRDDVALEGVSHFFRELAEEKR
EGYERLLKMQNQRGGRALFQDIKKPAQDEWGKTLDAMEAAMALEKNLNQALLDLHALGSA
RTDPHLCDFLESHFLDEEVKIIKKMGDHLTNLRRLASPQAGLGEYLFERLTLKHD
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgagctcccagattcgtcagaattattccaccgacgtggaggcagccgtcaaccacctg
gtcaatgtgtacctgcaggcctcctacacctacctctctctgggctactatttcgaccgc
gatgatgtagctctggaaggcgtgagccacttcttccgcgaattggccgaggagaaacgc
gagggctatgagcgtctcctgaagatgcaaaaccagcgtggcggccgcgctctctttcag
gacatcaagaagccggctcaagatgagtggggtaaaaccctggacgccatggaagccgcc
atggccctggagaaaaatctgaaccaggctcttttggatcttcatgccctgggttctgcc
cgcacggacccccatctctgtgacttcctggagagtcacttcctagatgaggaagtgaaa
atcatcaagaagatgggtgaccacctgaccaacctccgcaggctggccagcccacaggct
gggctgggcgagtatctctttgaaaggctcactctcaagcacgactaa

DBGET integrated database retrieval system