KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100387550Help
Entry
100387550         CDS       T03264                                 

Gene name
LIF
Definition
(RefSeq) leukemia inhibitory factor
  KO
K05419  leukemia inhibitory factor
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04630  Jak-STAT signaling pathway
cjc04668  TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    100387550 (LIF)
   04668 TNF signaling pathway
    100387550 (LIF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100387550 (LIF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100387550 (LIF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100387550 (LIF)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  CSF and other factors
   100387550 (LIF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LIF_OSM
Motif
Other DBs
NCBI-GeneID: 100387550
NCBI-ProteinID: XP_002743712
Ensembl: ENSCJAG00000010302
UniProt: F7GQ12
Position
1
AA seq 202 aa AA seqDB search
MKVLAAGVVPLLLVLHWRHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSAN
ALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKARLVELYRIVVYLGTALGNIT
RDQKILNPSALSLHSKLNTTADILRGLLSNVLCRLCSKYHVAHVDVTYGPDTSGKDVFQK
KKLGCQLLGKYKQIIGMLAQAF
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcttggcggcaggagttgtgcccctgctgctggttctgcactggagacatggg
gcggggagccccctccccatcacccctgtcaacgccacctgtgccatacgccacccatgt
cacaacaacctcatgaaccagatcaggagccaactggcacagctcaatggcagtgccaat
gccctgtttattctctattacacagcccaaggcgagccattccccaacaacctggacaag
ctgtgcggccccaatgtgacggacttcccgcccttccatgccaatggcacggagaaggcc
aggctggtggagctgtaccgcatagttgtgtatctcggcaccgccctgggcaacatcacc
cgggaccagaagatcctcaaccccagcgccctcagcctccatagcaagctcaacaccact
gccgacattctgcgaggcctccttagcaacgtgctgtgccgcctgtgcagcaagtaccac
gtggcccacgtggacgtgacctacggccccgacacgtcgggtaaggacgtcttccagaag
aagaagctgggctgtcagctcctggggaagtataagcagatcatcggcatgttggctcag
gccttctag

DBGET integrated database retrieval system