KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100387570Help
Entry
100387570         CDS       T03264                                 

Gene name
CASP3
Definition
(RefSeq) caspase 3
  KO
K02187  caspase 3 [EC:3.4.22.56]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01524  Platinum drug resistance
cjc04010  MAPK signaling pathway
cjc04115  p53 signaling pathway
cjc04210  Apoptosis
cjc04215  Apoptosis - multiple species
cjc04650  Natural killer cell mediated cytotoxicity
cjc04657  IL-17 signaling pathway
cjc04668  TNF signaling pathway
cjc04726  Serotonergic synapse
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc05010  Alzheimer disease
cjc05012  Parkinson disease
cjc05014  Amyotrophic lateral sclerosis (ALS)
cjc05016  Huntington disease
cjc05133  Pertussis
cjc05134  Legionellosis
cjc05145  Toxoplasmosis
cjc05146  Amoebiasis
cjc05152  Tuberculosis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05165  Human papillomavirus infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05203  Viral carcinogenesis
cjc05205  Proteoglycans in cancer
cjc05206  MicroRNAs in cancer
cjc05210  Colorectal cancer
cjc05222  Small cell lung cancer
cjc05416  Viral myocarditis
Module
cjc_M00685  Apoptotic machinery
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100387570 (CASP3)
   04668 TNF signaling pathway
    100387570 (CASP3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100387570 (CASP3)
   04215 Apoptosis - multiple species
    100387570 (CASP3)
   04115 p53 signaling pathway
    100387570 (CASP3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100387570 (CASP3)
   04657 IL-17 signaling pathway
    100387570 (CASP3)
  09156 Nervous system
   04726 Serotonergic synapse
    100387570 (CASP3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100387570 (CASP3)
   05206 MicroRNAs in cancer
    100387570 (CASP3)
   05205 Proteoglycans in cancer
    100387570 (CASP3)
   05203 Viral carcinogenesis
    100387570 (CASP3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100387570 (CASP3)
   05222 Small cell lung cancer
    100387570 (CASP3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100387570 (CASP3)
   05012 Parkinson disease
    100387570 (CASP3)
   05014 Amyotrophic lateral sclerosis (ALS)
    100387570 (CASP3)
   05016 Huntington disease
    100387570 (CASP3)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100387570 (CASP3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100387570 (CASP3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100387570 (CASP3)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100387570 (CASP3)
   05134 Legionellosis
    100387570 (CASP3)
   05152 Tuberculosis
    100387570 (CASP3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100387570 (CASP3)
   05162 Measles
    100387570 (CASP3)
   05164 Influenza A
    100387570 (CASP3)
   05161 Hepatitis B
    100387570 (CASP3)
   05160 Hepatitis C
    100387570 (CASP3)
   05168 Herpes simplex virus 1 infection
    100387570 (CASP3)
   05163 Human cytomegalovirus infection
    100387570 (CASP3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100387570 (CASP3)
   05169 Epstein-Barr virus infection
    100387570 (CASP3)
   05165 Human papillomavirus infection
    100387570 (CASP3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100387570 (CASP3)
   05145 Toxoplasmosis
    100387570 (CASP3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100387570 (CASP3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cjc01002]
    100387570 (CASP3)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.56  caspase-3
     100387570 (CASP3)
Peptidases [BR:cjc01002]
 Cysteine Peptidases
  Family C14: caspase family
   100387570 (CASP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C14
Motif
Other DBs
NCBI-GeneID: 100387570
NCBI-ProteinID: XP_002745227
Ensembl: ENSCJAG00000005740
Position
3
AA seq 284 aa AA seqDB search
MELIKVSMENTENSVDSKSIKNSERKIIHGSKSVDSGISLDSSYKMDYPEMGLCLIINNK
NFHKSTGMASRSGTDVDAANLRETFMNLKYEVRNKNDLTREEIVELMRNVSKEDHSKRSS
FVCVLLSHGEEGIIFGTNGPVDLKKITSFFRGDCCRSLTGKPKLFIIQACRGTELDCGIE
TDSGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSRDGSWFIQSLCAMLKLYANKLEFM
HILTRVNRKVATEFESSSFDATFHAKKQIPCIVSMLTKELYFYQ
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggagttaataaaggtatccatggagaacactgaaaactcagtggattcaaaatccatt
aaaaattcggaacgaaagatcatacatggaagcaaatcagtggactctggtatatccctg
gacagcagttataaaatggattatcctgaaatgggtttatgtctaataattaataataag
aactttcataaaagcactggaatggcatctcggtctggtacagatgtggatgcagcaaac
ctcagggaaactttcatgaacttgaaatatgaagtcaggaataaaaacgatctcacacgc
gaagagattgtggaactgatgcgtaatgtttctaaagaagatcacagcaaaaggagcagt
ttcgtttgtgtgcttctgagccatggtgaagaaggaataatttttggaaccaatggacct
gttgacctgaaaaaaataacaagctttttcagaggggattgttgtagaagtctaactgga
aaacccaaacttttcattattcaggcctgccgtggcacagaactggactgtggcattgag
acggacagcggtgttgatgatgacatggcgtgtcataaaataccagtggaggccgacttc
ttgtatgcatactccacagcacctggttattattcctggcgaaattcaagggacggctcc
tggttcatccagtcgctttgtgccatgctgaagctgtatgccaacaagcttgagttcatg
catatcctgacccgggttaaccgaaaggtggcaacagaatttgagtcctcttcctttgat
gctacttttcatgcaaagaaacagattccatgtattgtttccatgctcacgaaagaactg
tatttttatcagtaa

DBGET integrated database retrieval system