KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100387612Help
Entry
100387612         CDS       T03264                                 

Gene name
CCL2
Definition
(RefSeq) C-C motif chemokine ligand 2
  KO
K14624  C-C motif chemokine 2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04062  Chemokine signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04657  IL-17 signaling pathway
cjc04668  TNF signaling pathway
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc05142  Chagas disease (American trypanosomiasis)
cjc05144  Malaria
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05168  Herpes simplex virus 1 infection
cjc05323  Rheumatoid arthritis
cjc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100387612 (CCL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100387612 (CCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100387612 (CCL2)
   04657 IL-17 signaling pathway
    100387612 (CCL2)
   04062 Chemokine signaling pathway
    100387612 (CCL2)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    100387612 (CCL2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100387612 (CCL2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100387612 (CCL2)
  09172 Infectious disease: viral
   05164 Influenza A
    100387612 (CCL2)
   05168 Herpes simplex virus 1 infection
    100387612 (CCL2)
   05163 Human cytomegalovirus infection
    100387612 (CCL2)
  09174 Infectious disease: parasitic
   05144 Malaria
    100387612 (CCL2)
   05142 Chagas disease (American trypanosomiasis)
    100387612 (CCL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100387612 (CCL2)
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100387612 (CCL2)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Chemokines
   100387612 (CCL2)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate/Haparin
  Chemokines
   100387612 (CCL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8 GPR15L
Motif
Other DBs
NCBI-GeneID: 100387612
NCBI-ProteinID: XP_002748379
Ensembl: ENSCJAG00000037241
UniProt: A0A2R8MEX9
Position
5
AA seq 98 aa AA seqDB search
MVSAALLCLLLIAATFSPQGLAQPDAINAPVTCCYIFTNKRISLQRLASYRRITSSKCPK
EAVIFKTKLAKEICADPKQKWVEDSIDHLDKQIQTPKP
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atggtctctgcagcacttctgtgcctgctgctcatagcagccaccttcagcccccagggg
ctcgctcagccagatgcaatcaatgccccagttacctgctgttacatcttcaccaataag
aggatctcactgcagaggctggcaagctacagaagaatcaccagcagcaagtgtcccaaa
gaagctgtgatcttcaagaccaaactggccaaggagatctgtgctgatcccaagcagaag
tgggttgaagattccattgaccacctggacaagcaaatccaaactccaaagccttga

DBGET integrated database retrieval system