KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100387686Help
Entry
100387686         CDS       T03264                                 

Gene name
MAPK9
Definition
(RefSeq) mitogen-activated protein kinase 9
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01522  Endocrine resistance
cjc04010  MAPK signaling pathway
cjc04012  ErbB signaling pathway
cjc04014  Ras signaling pathway
cjc04024  cAMP signaling pathway
cjc04068  FoxO signaling pathway
cjc04071  Sphingolipid signaling pathway
cjc04137  Mitophagy - animal
cjc04140  Autophagy - animal
cjc04141  Protein processing in endoplasmic reticulum
cjc04210  Apoptosis
cjc04215  Apoptosis - multiple species
cjc04217  Necroptosis
cjc04310  Wnt signaling pathway
cjc04380  Osteoclast differentiation
cjc04510  Focal adhesion
cjc04530  Tight junction
cjc04620  Toll-like receptor signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04622  RIG-I-like receptor signaling pathway
cjc04625  C-type lectin receptor signaling pathway
cjc04657  IL-17 signaling pathway
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04664  Fc epsilon RI signaling pathway
cjc04668  TNF signaling pathway
cjc04722  Neurotrophin signaling pathway
cjc04723  Retrograde endocannabinoid signaling
cjc04728  Dopaminergic synapse
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04910  Insulin signaling pathway
cjc04912  GnRH signaling pathway
cjc04914  Progesterone-mediated oocyte maturation
cjc04917  Prolactin signaling pathway
cjc04920  Adipocytokine signaling pathway
cjc04926  Relaxin signaling pathway
cjc04930  Type II diabetes mellitus
cjc04931  Insulin resistance
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc05132  Salmonella infection
cjc05133  Pertussis
cjc05142  Chagas disease (American trypanosomiasis)
cjc05145  Toxoplasmosis
cjc05152  Tuberculosis
cjc05161  Hepatitis B
cjc05162  Measles
cjc05166  Human T-cell leukemia virus 1 infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05210  Colorectal cancer
cjc05212  Pancreatic cancer
cjc05231  Choline metabolism in cancer
cjc05418  Fluid shear stress and atherosclerosis
Module
cjc_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100387686 (MAPK9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100387686 (MAPK9)
   04010 MAPK signaling pathway
    100387686 (MAPK9)
   04012 ErbB signaling pathway
    100387686 (MAPK9)
   04310 Wnt signaling pathway
    100387686 (MAPK9)
   04668 TNF signaling pathway
    100387686 (MAPK9)
   04068 FoxO signaling pathway
    100387686 (MAPK9)
   04071 Sphingolipid signaling pathway
    100387686 (MAPK9)
   04024 cAMP signaling pathway
    100387686 (MAPK9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100387686 (MAPK9)
   04137 Mitophagy - animal
    100387686 (MAPK9)
  09143 Cell growth and death
   04210 Apoptosis
    100387686 (MAPK9)
   04215 Apoptosis - multiple species
    100387686 (MAPK9)
   04217 Necroptosis
    100387686 (MAPK9)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100387686 (MAPK9)
   04530 Tight junction
    100387686 (MAPK9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100387686 (MAPK9)
   04621 NOD-like receptor signaling pathway
    100387686 (MAPK9)
   04622 RIG-I-like receptor signaling pathway
    100387686 (MAPK9)
   04625 C-type lectin receptor signaling pathway
    100387686 (MAPK9)
   04658 Th1 and Th2 cell differentiation
    100387686 (MAPK9)
   04659 Th17 cell differentiation
    100387686 (MAPK9)
   04657 IL-17 signaling pathway
    100387686 (MAPK9)
   04664 Fc epsilon RI signaling pathway
    100387686 (MAPK9)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100387686 (MAPK9)
   04920 Adipocytokine signaling pathway
    100387686 (MAPK9)
   04912 GnRH signaling pathway
    100387686 (MAPK9)
   04914 Progesterone-mediated oocyte maturation
    100387686 (MAPK9)
   04917 Prolactin signaling pathway
    100387686 (MAPK9)
   04926 Relaxin signaling pathway
    100387686 (MAPK9)
  09156 Nervous system
   04728 Dopaminergic synapse
    100387686 (MAPK9)
   04723 Retrograde endocannabinoid signaling
    100387686 (MAPK9)
   04722 Neurotrophin signaling pathway
    100387686 (MAPK9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100387686 (MAPK9)
  09158 Development
   04380 Osteoclast differentiation
    100387686 (MAPK9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100387686 (MAPK9)
   05231 Choline metabolism in cancer
    100387686 (MAPK9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100387686 (MAPK9)
   05212 Pancreatic cancer
    100387686 (MAPK9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100387686 (MAPK9)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100387686 (MAPK9)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100387686 (MAPK9)
   04931 Insulin resistance
    100387686 (MAPK9)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100387686 (MAPK9)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100387686 (MAPK9)
   05133 Pertussis
    100387686 (MAPK9)
   05152 Tuberculosis
    100387686 (MAPK9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100387686 (MAPK9)
   05170 Human immunodeficiency virus 1 infection
    100387686 (MAPK9)
   05162 Measles
    100387686 (MAPK9)
   05161 Hepatitis B
    100387686 (MAPK9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100387686 (MAPK9)
   05169 Epstein-Barr virus infection
    100387686 (MAPK9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100387686 (MAPK9)
   05142 Chagas disease (American trypanosomiasis)
    100387686 (MAPK9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100387686 (MAPK9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100387686 (MAPK9)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100387686 (MAPK9)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100387686 (MAPK9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like APH RIO1 FTA2
Motif
Other DBs
NCBI-GeneID: 100387686
NCBI-ProteinID: XP_002744512
Ensembl: ENSCJAG00000010293
UniProt: U3EWQ9
Position
2
AA seq 424 aa AA seqDB search
MSDSKCDSQFYSVQVADSTFTVLKRYQQLKSIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMAEMVLHKVLFPGRDYIDQWNKVIEQ
LGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGVVKDQTSDAAVSSNATPSQSSSINDISSMSTEQTLASDTDSSLDASTGPL
EGCR
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacagtaaatgtgacagtcagttttacagtgtgcaagtggcagactcaactttc
actgtcctaaaacgttaccagcagctgaaatcgattggctctggtgcccaagggattgtt
tgtgctgcatttgatacagttcttgggataaatgttgcagtcaagaaactaagccgtcct
tttcagaatcaaactcatgcaaagagagcttatcgtgaacttgtcctcttaaaatgtgtc
aatcacaaaaatataattagtttgttaaatgtgtttacaccacaaaaaactctagaagaa
tttcaagatgtgtatttggttatggaattaatggatgctaacttatgtcaggttattcac
atggagttggatcatgaaagaatgtcctatcttctttaccagatgctttgtggtattaaa
catctgcattcagctggtataattcatagagatttgaagcctagcaacattgttgtgaaa
tcagactgcaccctgaagatccttgactttggcctggcacgcacagcgtgcactaacttt
atgatgactccttatgtggtgacacggtactaccgggcacctgaagtcatcctgggtatg
ggctacaaagagaatgtggacatctggtctgtcgggtgcatcatggcagaaatggtcctc
cataaagtcctgttcccaggaagagactatatcgatcagtggaataaagttattgagcaa
cttggaacaccatcagcagagttcatgaagaaacttcagccaactgtgagaaattatgta
gaaaacagaccaaagtatcctggaatcaaattcgaagaactctttccagattggatattc
ccatcagaatctgaacgagacaaaataaaaacaagtcaagccagagatctcttatcaaaa
atgttagtgattgatcctgacaagcgaatctctgtagacgaagctctgcgtcacccatac
atcactgtttggtatgatcctgctgaagcagaagcaccaccacctcaaatttatgatgcc
cagctggaagaaagagaacatgcaattgaagaatggaaagagctaatttacaaagaagtc
atggattgggaagaaagaagcaagaatggtgttgtaaaagatcagacttcagatgcagca
gtaagtagcaacgccactccttctcagtcttcatctatcaatgacatttcatccatgtcc
actgagcagacactggcctcagacacagacagcagtctcgatgcctcgacgggacccctt
gaaggttgtcgatga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100390109Help
Entry
100390109         CDS       T03264                                 

Gene name
MAPK10
Definition
(RefSeq) mitogen-activated protein kinase 10
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01522  Endocrine resistance
cjc04010  MAPK signaling pathway
cjc04012  ErbB signaling pathway
cjc04014  Ras signaling pathway
cjc04024  cAMP signaling pathway
cjc04068  FoxO signaling pathway
cjc04071  Sphingolipid signaling pathway
cjc04137  Mitophagy - animal
cjc04140  Autophagy - animal
cjc04141  Protein processing in endoplasmic reticulum
cjc04210  Apoptosis
cjc04215  Apoptosis - multiple species
cjc04217  Necroptosis
cjc04310  Wnt signaling pathway
cjc04380  Osteoclast differentiation
cjc04510  Focal adhesion
cjc04530  Tight junction
cjc04620  Toll-like receptor signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04622  RIG-I-like receptor signaling pathway
cjc04625  C-type lectin receptor signaling pathway
cjc04657  IL-17 signaling pathway
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04664  Fc epsilon RI signaling pathway
cjc04668  TNF signaling pathway
cjc04722  Neurotrophin signaling pathway
cjc04723  Retrograde endocannabinoid signaling
cjc04728  Dopaminergic synapse
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04910  Insulin signaling pathway
cjc04912  GnRH signaling pathway
cjc04914  Progesterone-mediated oocyte maturation
cjc04917  Prolactin signaling pathway
cjc04920  Adipocytokine signaling pathway
cjc04926  Relaxin signaling pathway
cjc04930  Type II diabetes mellitus
cjc04931  Insulin resistance
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc05132  Salmonella infection
cjc05133  Pertussis
cjc05142  Chagas disease (American trypanosomiasis)
cjc05145  Toxoplasmosis
cjc05152  Tuberculosis
cjc05161  Hepatitis B
cjc05162  Measles
cjc05166  Human T-cell leukemia virus 1 infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05210  Colorectal cancer
cjc05212  Pancreatic cancer
cjc05231  Choline metabolism in cancer
cjc05418  Fluid shear stress and atherosclerosis
Module
cjc_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100390109 (MAPK10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100390109 (MAPK10)
   04010 MAPK signaling pathway
    100390109 (MAPK10)
   04012 ErbB signaling pathway
    100390109 (MAPK10)
   04310 Wnt signaling pathway
    100390109 (MAPK10)
   04668 TNF signaling pathway
    100390109 (MAPK10)
   04068 FoxO signaling pathway
    100390109 (MAPK10)
   04071 Sphingolipid signaling pathway
    100390109 (MAPK10)
   04024 cAMP signaling pathway
    100390109 (MAPK10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100390109 (MAPK10)
   04137 Mitophagy - animal
    100390109 (MAPK10)
  09143 Cell growth and death
   04210 Apoptosis
    100390109 (MAPK10)
   04215 Apoptosis - multiple species
    100390109 (MAPK10)
   04217 Necroptosis
    100390109 (MAPK10)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100390109 (MAPK10)
   04530 Tight junction
    100390109 (MAPK10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100390109 (MAPK10)
   04621 NOD-like receptor signaling pathway
    100390109 (MAPK10)
   04622 RIG-I-like receptor signaling pathway
    100390109 (MAPK10)
   04625 C-type lectin receptor signaling pathway
    100390109 (MAPK10)
   04658 Th1 and Th2 cell differentiation
    100390109 (MAPK10)
   04659 Th17 cell differentiation
    100390109 (MAPK10)
   04657 IL-17 signaling pathway
    100390109 (MAPK10)
   04664 Fc epsilon RI signaling pathway
    100390109 (MAPK10)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100390109 (MAPK10)
   04920 Adipocytokine signaling pathway
    100390109 (MAPK10)
   04912 GnRH signaling pathway
    100390109 (MAPK10)
   04914 Progesterone-mediated oocyte maturation
    100390109 (MAPK10)
   04917 Prolactin signaling pathway
    100390109 (MAPK10)
   04926 Relaxin signaling pathway
    100390109 (MAPK10)
  09156 Nervous system
   04728 Dopaminergic synapse
    100390109 (MAPK10)
   04723 Retrograde endocannabinoid signaling
    100390109 (MAPK10)
   04722 Neurotrophin signaling pathway
    100390109 (MAPK10)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100390109 (MAPK10)
  09158 Development
   04380 Osteoclast differentiation
    100390109 (MAPK10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100390109 (MAPK10)
   05231 Choline metabolism in cancer
    100390109 (MAPK10)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100390109 (MAPK10)
   05212 Pancreatic cancer
    100390109 (MAPK10)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100390109 (MAPK10)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100390109 (MAPK10)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100390109 (MAPK10)
   04931 Insulin resistance
    100390109 (MAPK10)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100390109 (MAPK10)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100390109 (MAPK10)
   05133 Pertussis
    100390109 (MAPK10)
   05152 Tuberculosis
    100390109 (MAPK10)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100390109 (MAPK10)
   05170 Human immunodeficiency virus 1 infection
    100390109 (MAPK10)
   05162 Measles
    100390109 (MAPK10)
   05161 Hepatitis B
    100390109 (MAPK10)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100390109 (MAPK10)
   05169 Epstein-Barr virus infection
    100390109 (MAPK10)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100390109 (MAPK10)
   05142 Chagas disease (American trypanosomiasis)
    100390109 (MAPK10)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100390109 (MAPK10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100390109 (MAPK10)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100390109 (MAPK10)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100390109 (MAPK10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like RIO1 APH FTA2 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 100390109
NCBI-ProteinID: XP_002745674
Ensembl: ENSCJAG00000005621
UniProt: F7HNH3
Position
3
AA seq 426 aa AA seqDB search
MSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQ
LGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSK
MLVIDPAKRISVDDALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEV
MNSEEKTKNGVVKGQPSPSGAAVNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAG
PLGCCR
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaagcaaagttgacaaccagttctacagtgtggaagtgggagactcaaccttc
acagttctcaagcgctaccagaatctaaagcctattggctctggggctcagggcatagtt
tgtgccgcgtatgatgctgtccttgacagaaatgtggccattaagaagctcagcagaccc
tttcagaaccaaacacatgccaagagagcataccgggagctggtcctcatgaagtgtgtg
aaccataaaaacatcattagtttattaaatgtcttcacaccccagaaaacgctggaggag
ttccaagatgtttacttagtaatggaactgatggatgccaacttatgtcaagtgatccag
atggaattagaccacgagcgaatgtcttacctgctgtaccaaatgctgtgtggcattaag
cacctccactctgctggaattattcacagggatttaaaaccaagtaacattgtagtcaag
tctgattgcacattgaaaatcctggactttggactggccaggacagcaggcacaagcttc
atgatgactccgtatgtggtgacacgttattacagagccccggaggtcatcctggggatg
ggctacaaggagaacgtggatatatggtctgtgggatgcattatgggagaaatggttcgc
cacaaaatcctctttccaggaagggactatattgaccagtggaataaggtaattgaacaa
ctaggaacaccatgtccagaattcatgaagaaattgcaacccacagtaagaaactatgtg
gagaatcggcccaagtatgcaggactcaccttccccaagctcttcccagattccctcttc
ccagcggactctgagcacaataaactcaaagccagccaagccagggacttgttgtcaaag
atgctagtgattgacccagcaaaaagaatatcagtggacgacgccttacagcatccctac
atcaatgtttggtatgacccagctgaagtggaggcgcctccacctcagatatatgacaag
cagttggatgaaagagaacacacaattgaagaatggaaagaacttatctacaaggaagta
atgaactcggaagaaaagactaaaaatggcgtagtaaaaggacagccttctccttcaggt
gcagcagtgaacagcagtgagagtctccctccatcctcgtctgtcaatgacatctcctcc
atgtccacggaccagaccctggcatctgacactgacagcagcctggaagcctcggcagga
cccctgggttgttgcaggtga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100392721Help
Entry
100392721         CDS       T03264                                 

Gene name
MAPK8
Definition
(RefSeq) mitogen-activated protein kinase 8
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01522  Endocrine resistance
cjc04010  MAPK signaling pathway
cjc04012  ErbB signaling pathway
cjc04014  Ras signaling pathway
cjc04024  cAMP signaling pathway
cjc04068  FoxO signaling pathway
cjc04071  Sphingolipid signaling pathway
cjc04137  Mitophagy - animal
cjc04140  Autophagy - animal
cjc04141  Protein processing in endoplasmic reticulum
cjc04210  Apoptosis
cjc04215  Apoptosis - multiple species
cjc04217  Necroptosis
cjc04310  Wnt signaling pathway
cjc04380  Osteoclast differentiation
cjc04510  Focal adhesion
cjc04530  Tight junction
cjc04620  Toll-like receptor signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04622  RIG-I-like receptor signaling pathway
cjc04625  C-type lectin receptor signaling pathway
cjc04657  IL-17 signaling pathway
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04664  Fc epsilon RI signaling pathway
cjc04668  TNF signaling pathway
cjc04722  Neurotrophin signaling pathway
cjc04723  Retrograde endocannabinoid signaling
cjc04728  Dopaminergic synapse
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04910  Insulin signaling pathway
cjc04912  GnRH signaling pathway
cjc04914  Progesterone-mediated oocyte maturation
cjc04917  Prolactin signaling pathway
cjc04920  Adipocytokine signaling pathway
cjc04926  Relaxin signaling pathway
cjc04930  Type II diabetes mellitus
cjc04931  Insulin resistance
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc05132  Salmonella infection
cjc05133  Pertussis
cjc05142  Chagas disease (American trypanosomiasis)
cjc05145  Toxoplasmosis
cjc05152  Tuberculosis
cjc05161  Hepatitis B
cjc05162  Measles
cjc05166  Human T-cell leukemia virus 1 infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05210  Colorectal cancer
cjc05212  Pancreatic cancer
cjc05231  Choline metabolism in cancer
cjc05418  Fluid shear stress and atherosclerosis
Module
cjc_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100392721 (MAPK8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100392721 (MAPK8)
   04010 MAPK signaling pathway
    100392721 (MAPK8)
   04012 ErbB signaling pathway
    100392721 (MAPK8)
   04310 Wnt signaling pathway
    100392721 (MAPK8)
   04668 TNF signaling pathway
    100392721 (MAPK8)
   04068 FoxO signaling pathway
    100392721 (MAPK8)
   04071 Sphingolipid signaling pathway
    100392721 (MAPK8)
   04024 cAMP signaling pathway
    100392721 (MAPK8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100392721 (MAPK8)
   04137 Mitophagy - animal
    100392721 (MAPK8)
  09143 Cell growth and death
   04210 Apoptosis
    100392721 (MAPK8)
   04215 Apoptosis - multiple species
    100392721 (MAPK8)
   04217 Necroptosis
    100392721 (MAPK8)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100392721 (MAPK8)
   04530 Tight junction
    100392721 (MAPK8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100392721 (MAPK8)
   04621 NOD-like receptor signaling pathway
    100392721 (MAPK8)
   04622 RIG-I-like receptor signaling pathway
    100392721 (MAPK8)
   04625 C-type lectin receptor signaling pathway
    100392721 (MAPK8)
   04658 Th1 and Th2 cell differentiation
    100392721 (MAPK8)
   04659 Th17 cell differentiation
    100392721 (MAPK8)
   04657 IL-17 signaling pathway
    100392721 (MAPK8)
   04664 Fc epsilon RI signaling pathway
    100392721 (MAPK8)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100392721 (MAPK8)
   04920 Adipocytokine signaling pathway
    100392721 (MAPK8)
   04912 GnRH signaling pathway
    100392721 (MAPK8)
   04914 Progesterone-mediated oocyte maturation
    100392721 (MAPK8)
   04917 Prolactin signaling pathway
    100392721 (MAPK8)
   04926 Relaxin signaling pathway
    100392721 (MAPK8)
  09156 Nervous system
   04728 Dopaminergic synapse
    100392721 (MAPK8)
   04723 Retrograde endocannabinoid signaling
    100392721 (MAPK8)
   04722 Neurotrophin signaling pathway
    100392721 (MAPK8)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100392721 (MAPK8)
  09158 Development
   04380 Osteoclast differentiation
    100392721 (MAPK8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100392721 (MAPK8)
   05231 Choline metabolism in cancer
    100392721 (MAPK8)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100392721 (MAPK8)
   05212 Pancreatic cancer
    100392721 (MAPK8)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100392721 (MAPK8)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100392721 (MAPK8)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100392721 (MAPK8)
   04931 Insulin resistance
    100392721 (MAPK8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100392721 (MAPK8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100392721 (MAPK8)
   05133 Pertussis
    100392721 (MAPK8)
   05152 Tuberculosis
    100392721 (MAPK8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100392721 (MAPK8)
   05170 Human immunodeficiency virus 1 infection
    100392721 (MAPK8)
   05162 Measles
    100392721 (MAPK8)
   05161 Hepatitis B
    100392721 (MAPK8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100392721 (MAPK8)
   05169 Epstein-Barr virus infection
    100392721 (MAPK8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100392721 (MAPK8)
   05142 Chagas disease (American trypanosomiasis)
    100392721 (MAPK8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100392721 (MAPK8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100392721 (MAPK8)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100392721 (MAPK8)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100392721 (MAPK8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like RIO1 APH FTA2 DUF530
Motif
Other DBs
NCBI-GeneID: 100392721
NCBI-ProteinID: XP_002756177
Ensembl: ENSCJAG00000013551
UniProt: F7AJT6
Position
12
AA seq 427 aa AA seqDB search
MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDMSSMSTDPTLASDTDSSLEASA
GPLGCCR
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaagcaagcgtgacaacaatttttatagtgtagagattggagattctacattt
acagtcctgaaacgatatcagaatttaaaacctataggctcaggagctcaaggaatagta
tgtgcagcttatgatgccattcttgaaagaaatgttgcaatcaagaagctaagccgacca
tttcagaatcaaactcatgccaagcgggcctacagagagctagttcttatgaaatgtgtt
aatcacaaaaatataattggccttttgaatgttttcacaccacagaaatccctagaagaa
tttcaagatgtttacatagtcatggagctcatggatgcaaatctttgccaagtaattcag
atggagctagatcatgaaagaatgtcctaccttctctatcagatgctgtgtggaatcaag
caccttcactccgctggaattattcatcgggacttaaagcctagtaatatagtagtaaaa
tctgactgcactttgaagattcttgactttggtctggccaggactgcaggaacaagtttt
atgatgacgccttacgtagtgactcgctactacagagcacctgaggtcatccttggcatg
ggctacaaggaaaacgttgacatttggtcagttgggtgcatcatgggagaaatgatcaaa
ggtggtgttttgttcccaggtacagatcatattgatcaatggaataaagttattgagcag
cttggaacaccatgtcctgaattcatgaagaaactgcaaccaacagtcaggacttacgtt
gaaaacagacctaaatatgctggatatagcttcgagaaactcttccccgatgtacttttc
ccagctgactcagaacacaacaaacttaaagccagtcaggcaagggatttgttatccaaa
atgctggtaatagatgcatctaaaaggatctctgtagatgaggctctccagcacccgtac
atcaatgtctggtatgatccttctgaagcagaagctccaccaccaaagatacctgacaag
caattagatgaaagggaacacacaatagaagagtggaaagaattgatatataaggaagtt
atggacttggaggagagaaccaagaatggagttatacgggggcagccctctcctttaggt
gcagcagtgatcaatggctctcagcatccatcgtcatcatcgtctgtcaatgatatgtct
tcaatgtcaacagatccgactttggcctcggatacagacagcagtctagaagcatcagcg
gggcctctgggctgctgtagatga

DBGET integrated database retrieval system