KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100387894Help
Entry
100387894         CDS       T03264                                 

Gene name
IL33
Definition
(RefSeq) interleukin 33
  KO
K12967  interleukin 33
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04217  Necroptosis
cjc04623  Cytosolic DNA-sensing pathway
cjc05164  Influenza A
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100387894 (IL33)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100387894 (IL33)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    100387894 (IL33)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100387894 (IL33)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL33 UPF0489
Motif
Other DBs
NCBI-GeneID: 100387894
NCBI-ProteinID: XP_002742964
Ensembl: ENSCJAG00000011610
UniProt: A0A2R8PF76
Position
1
AA seq 270 aa AA seqDB search
MKPKMKYSTNRISTAKQKNTASKALCFKLAKSQQKAKEVCHVYFMKLRSGLTIKKEASYF
RRETTKRPSLKTGRKHKEHLVFTACQQQSTMKCFTFDISAVQKYTKALHAASIPGISPIT
ESLTSLSTYNDQSIIFALEDESYEIYVEDLKKDEEKDKVLLSYYESQCSSNESGDGVDGK
MLMVALSPIKDFWLHANNKEHSVELHKCEKPLPDQAFFILHNMPYNCVSFECKTDPGVFI
GVKDNHLALIKVDCSENLCSENILFKLSKS
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctaaaatgaagtattcaaccaacagaatttccacagccaagcagaagaacaca
gcaagcaaagccctgtgtttcaaactggcaaaatcccaacagaaggccaaagaagtttgc
catgtgtactttatgaagctccgctctggtcttacaataaaaaaggaggcctcttacttt
aggagagaaaccaccaaaagaccttcactaaaaacaggtagaaagcacaaagaacatctg
gtattcactgcctgtcaacagcaatctaccatgaagtgctttacctttgatatatcagca
gtccagaaatatactaaagcacttcatgctgcaagtatcccaggtatttcacctattaca
gaatctcttacttccctaagcacatacaatgatcaatccattatttttgctttggaggat
gagagttatgagatatatgttgaagacttgaaaaaagatgaagaaaaagacaaagtgtta
ctgagttactatgagtctcaatgctcctcaaatgaatcaggtgatggtgttgacggtaag
atgttaatggtagccctgagtcctataaaagacttctggttgcatgccaacaacaaggag
cactctgtggagctccataagtgtgaaaaaccactgccagaccaagccttctttatcctt
cataatatgccctacaactgtgtttcatttgaatgcaagactgatcctggagtgtttata
ggtgtaaaggataatcatcttgctctgattaaagtagactgttctgagaatttgtgtagt
gaaaatatcttgtttaagctctctaaaagttag

DBGET integrated database retrieval system