KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100387945Help
Entry
100387945         CDS       T03264                                 

Gene name
BAK1
Definition
(RefSeq) BCL2 antagonist/killer 1
  KO
K14021  Bcl-2 homologous antagonist/killer
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01524  Platinum drug resistance
cjc04141  Protein processing in endoplasmic reticulum
cjc04210  Apoptosis
cjc04215  Apoptosis - multiple species
cjc05160  Hepatitis C
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05165  Human papillomavirus infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05202  Transcriptional misregulation in cancer
cjc05203  Viral carcinogenesis
cjc05206  MicroRNAs in cancer
cjc05210  Colorectal cancer
cjc05212  Pancreatic cancer
cjc05213  Endometrial cancer
cjc05214  Glioma
cjc05216  Thyroid cancer
cjc05217  Basal cell carcinoma
cjc05218  Melanoma
cjc05220  Chronic myeloid leukemia
cjc05222  Small cell lung cancer
cjc05223  Non-small cell lung cancer
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100387945 (BAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100387945 (BAK1)
   04215 Apoptosis - multiple species
    100387945 (BAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100387945 (BAK1)
   05202 Transcriptional misregulation in cancer
    100387945 (BAK1)
   05206 MicroRNAs in cancer
    100387945 (BAK1)
   05203 Viral carcinogenesis
    100387945 (BAK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100387945 (BAK1)
   05212 Pancreatic cancer
    100387945 (BAK1)
   05225 Hepatocellular carcinoma
    100387945 (BAK1)
   05226 Gastric cancer
    100387945 (BAK1)
   05214 Glioma
    100387945 (BAK1)
   05216 Thyroid cancer
    100387945 (BAK1)
   05220 Chronic myeloid leukemia
    100387945 (BAK1)
   05217 Basal cell carcinoma
    100387945 (BAK1)
   05218 Melanoma
    100387945 (BAK1)
   05213 Endometrial cancer
    100387945 (BAK1)
   05224 Breast cancer
    100387945 (BAK1)
   05222 Small cell lung cancer
    100387945 (BAK1)
   05223 Non-small cell lung cancer
    100387945 (BAK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100387945 (BAK1)
   05162 Measles
    100387945 (BAK1)
   05164 Influenza A
    100387945 (BAK1)
   05160 Hepatitis C
    100387945 (BAK1)
   05168 Herpes simplex virus 1 infection
    100387945 (BAK1)
   05163 Human cytomegalovirus infection
    100387945 (BAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100387945 (BAK1)
   05169 Epstein-Barr virus infection
    100387945 (BAK1)
   05165 Human papillomavirus infection
    100387945 (BAK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100387945 (BAK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cjc03029]
    100387945 (BAK1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cjc02000]
    100387945 (BAK1)
Mitochondrial biogenesis [BR:cjc03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    100387945 (BAK1)
Transporters [BR:cjc02000]
 Other Transporters
  Pores ion channels [TC:1]
   100387945 (BAK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bcl-2 Bcl-2_3
Motif
Other DBs
NCBI-GeneID: 100387945
NCBI-ProteinID: XP_002746482
Ensembl: ENSCJAG00000016047
UniProt: F7ICC2
Position
4
AA seq 211 aa AA seqDB search
MASGQGPGPPRQECGEPDPPSASEEQVARDTEEVFHSYVFYRHRQEQEAEGAAAPADPEM
VSLSLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIASSLFE
SGINWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAA
LDLGNGPILNVLVVLGVVLLGQFVVRRFFKS
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggcatcggggcaaggcccaggtcctcccaggcaggagtgcggagagcctgacccaccc
tctgcttctgaggagcaggtagcccgggacacagaggaggttttccacagctacgttttt
taccgccatcggcaggaacaggaggctgaaggggcggctgcccctgctgacccagagatg
gttagcttgtctctccaacctagcagcaccatggggcaggtgggacggcagctcgctatc
attggggatgacatcaaccggcgctatgactcggagttccagaccatgctgcagcacctg
cagcccacggcagagaacgcctacgagtacttcaccaagatcgcctccagcctgtttgag
agtggcatcaactggggccgtgtggtggctctcctgggctttggctaccgtctggcccta
cacgtctaccagcgcggcctgactggcttcctgggccaggtgacccgcttcgtggtggac
ttcatgctgcatcactgcatcgcccggtggatcgcacagaggggtggctgggtggcagcc
ctggacctgggcaatggacccatcctgaatgtgctggtcgttctgggtgtggttctgttg
ggccagtttgtggtacgaagattcttcaaatcatga

DBGET integrated database retrieval system