KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100388080Help
Entry
100388080         CDS       T03264                                 

Gene name
AKT2
Definition
(RefSeq) AKT serine/threonine kinase 2
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc01522  Endocrine resistance
cjc01524  Platinum drug resistance
cjc04010  MAPK signaling pathway
cjc04012  ErbB signaling pathway
cjc04014  Ras signaling pathway
cjc04015  Rap1 signaling pathway
cjc04022  cGMP-PKG signaling pathway
cjc04024  cAMP signaling pathway
cjc04062  Chemokine signaling pathway
cjc04066  HIF-1 signaling pathway
cjc04068  FoxO signaling pathway
cjc04071  Sphingolipid signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04140  Autophagy - animal
cjc04150  mTOR signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04152  AMPK signaling pathway
cjc04210  Apoptosis
cjc04211  Longevity regulating pathway
cjc04213  Longevity regulating pathway - multiple species
cjc04218  Cellular senescence
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04370  VEGF signaling pathway
cjc04371  Apelin signaling pathway
cjc04380  Osteoclast differentiation
cjc04510  Focal adhesion
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04611  Platelet activation
cjc04620  Toll-like receptor signaling pathway
cjc04625  C-type lectin receptor signaling pathway
cjc04630  Jak-STAT signaling pathway
cjc04660  T cell receptor signaling pathway
cjc04662  B cell receptor signaling pathway
cjc04664  Fc epsilon RI signaling pathway
cjc04666  Fc gamma R-mediated phagocytosis
cjc04668  TNF signaling pathway
cjc04722  Neurotrophin signaling pathway
cjc04725  Cholinergic synapse
cjc04728  Dopaminergic synapse
cjc04910  Insulin signaling pathway
cjc04914  Progesterone-mediated oocyte maturation
cjc04915  Estrogen signaling pathway
cjc04917  Prolactin signaling pathway
cjc04919  Thyroid hormone signaling pathway
cjc04920  Adipocytokine signaling pathway
cjc04922  Glucagon signaling pathway
cjc04923  Regulation of lipolysis in adipocytes
cjc04926  Relaxin signaling pathway
cjc04931  Insulin resistance
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc04973  Carbohydrate digestion and absorption
cjc05142  Chagas disease (American trypanosomiasis)
cjc05145  Toxoplasmosis
cjc05152  Tuberculosis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05165  Human papillomavirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05210  Colorectal cancer
cjc05211  Renal cell carcinoma
cjc05212  Pancreatic cancer
cjc05213  Endometrial cancer
cjc05214  Glioma
cjc05215  Prostate cancer
cjc05218  Melanoma
cjc05220  Chronic myeloid leukemia
cjc05221  Acute myeloid leukemia
cjc05222  Small cell lung cancer
cjc05223  Non-small cell lung cancer
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
cjc05230  Central carbon metabolism in cancer
cjc05231  Choline metabolism in cancer
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cjc05418  Fluid shear stress and atherosclerosis
Module
cjc_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100388080 (AKT2)
   04015 Rap1 signaling pathway
    100388080 (AKT2)
   04010 MAPK signaling pathway
    100388080 (AKT2)
   04012 ErbB signaling pathway
    100388080 (AKT2)
   04370 VEGF signaling pathway
    100388080 (AKT2)
   04371 Apelin signaling pathway
    100388080 (AKT2)
   04630 Jak-STAT signaling pathway
    100388080 (AKT2)
   04668 TNF signaling pathway
    100388080 (AKT2)
   04066 HIF-1 signaling pathway
    100388080 (AKT2)
   04068 FoxO signaling pathway
    100388080 (AKT2)
   04072 Phospholipase D signaling pathway
    100388080 (AKT2)
   04071 Sphingolipid signaling pathway
    100388080 (AKT2)
   04024 cAMP signaling pathway
    100388080 (AKT2)
   04022 cGMP-PKG signaling pathway
    100388080 (AKT2)
   04151 PI3K-Akt signaling pathway
    100388080 (AKT2)
   04152 AMPK signaling pathway
    100388080 (AKT2)
   04150 mTOR signaling pathway
    100388080 (AKT2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100388080 (AKT2)
  09143 Cell growth and death
   04210 Apoptosis
    100388080 (AKT2)
   04218 Cellular senescence
    100388080 (AKT2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100388080 (AKT2)
   04550 Signaling pathways regulating pluripotency of stem cells
    100388080 (AKT2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100388080 (AKT2)
   04620 Toll-like receptor signaling pathway
    100388080 (AKT2)
   04625 C-type lectin receptor signaling pathway
    100388080 (AKT2)
   04660 T cell receptor signaling pathway
    100388080 (AKT2)
   04662 B cell receptor signaling pathway
    100388080 (AKT2)
   04664 Fc epsilon RI signaling pathway
    100388080 (AKT2)
   04666 Fc gamma R-mediated phagocytosis
    100388080 (AKT2)
   04062 Chemokine signaling pathway
    100388080 (AKT2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100388080 (AKT2)
   04922 Glucagon signaling pathway
    100388080 (AKT2)
   04923 Regulation of lipolysis in adipocytes
    100388080 (AKT2)
   04920 Adipocytokine signaling pathway
    100388080 (AKT2)
   04915 Estrogen signaling pathway
    100388080 (AKT2)
   04914 Progesterone-mediated oocyte maturation
    100388080 (AKT2)
   04917 Prolactin signaling pathway
    100388080 (AKT2)
   04926 Relaxin signaling pathway
    100388080 (AKT2)
   04919 Thyroid hormone signaling pathway
    100388080 (AKT2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100388080 (AKT2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100388080 (AKT2)
  09156 Nervous system
   04725 Cholinergic synapse
    100388080 (AKT2)
   04728 Dopaminergic synapse
    100388080 (AKT2)
   04722 Neurotrophin signaling pathway
    100388080 (AKT2)
  09158 Development
   04380 Osteoclast differentiation
    100388080 (AKT2)
  09149 Aging
   04211 Longevity regulating pathway
    100388080 (AKT2)
   04213 Longevity regulating pathway - multiple species
    100388080 (AKT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100388080 (AKT2)
   05205 Proteoglycans in cancer
    100388080 (AKT2)
   05230 Central carbon metabolism in cancer
    100388080 (AKT2)
   05231 Choline metabolism in cancer
    100388080 (AKT2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100388080 (AKT2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100388080 (AKT2)
   05212 Pancreatic cancer
    100388080 (AKT2)
   05225 Hepatocellular carcinoma
    100388080 (AKT2)
   05226 Gastric cancer
    100388080 (AKT2)
   05214 Glioma
    100388080 (AKT2)
   05221 Acute myeloid leukemia
    100388080 (AKT2)
   05220 Chronic myeloid leukemia
    100388080 (AKT2)
   05218 Melanoma
    100388080 (AKT2)
   05211 Renal cell carcinoma
    100388080 (AKT2)
   05215 Prostate cancer
    100388080 (AKT2)
   05213 Endometrial cancer
    100388080 (AKT2)
   05224 Breast cancer
    100388080 (AKT2)
   05222 Small cell lung cancer
    100388080 (AKT2)
   05223 Non-small cell lung cancer
    100388080 (AKT2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100388080 (AKT2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100388080 (AKT2)
   04931 Insulin resistance
    100388080 (AKT2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100388080 (AKT2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100388080 (AKT2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100388080 (AKT2)
   05170 Human immunodeficiency virus 1 infection
    100388080 (AKT2)
   05162 Measles
    100388080 (AKT2)
   05164 Influenza A
    100388080 (AKT2)
   05161 Hepatitis B
    100388080 (AKT2)
   05160 Hepatitis C
    100388080 (AKT2)
   05168 Herpes simplex virus 1 infection
    100388080 (AKT2)
   05163 Human cytomegalovirus infection
    100388080 (AKT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100388080 (AKT2)
   05169 Epstein-Barr virus infection
    100388080 (AKT2)
   05165 Human papillomavirus infection
    100388080 (AKT2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100388080 (AKT2)
   05142 Chagas disease (American trypanosomiasis)
    100388080 (AKT2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100388080 (AKT2)
   01524 Platinum drug resistance
    100388080 (AKT2)
   01522 Endocrine resistance
    100388080 (AKT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100388080 (AKT2)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100388080 (AKT2)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   100388080 (AKT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PH Kinase-like Pkinase_C
Motif
Other DBs
NCBI-GeneID: 100388080
NCBI-ProteinID: XP_002762174
Ensembl: ENSCJAG00000014574
UniProt: F7I4A2
Position
22
AA seq 481 aa AA seqDB search
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRALGEDPM
DYKCGSPSDSSVAEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAQEVMEHRFFLSINWQDVVQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGSLELDQRTHFPQFSYSASIR
E
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaggtgtctgtcatcaaagaaggctggctccacaagcgcggtgaatacatcaag
acctggaggccacggtacttcctgctgaagagtgacggctccttcattgggtacaaggag
aggcctgaggcccctgatcagaccctgccccccttaaacaacttctctgtagcagaatgc
cagctgatgaagactgagaggccgaggcccaacaccttcgtcatacgctgcctgcagtgg
accacagtcatcgagaggaccttccacgtggattctccagatgagagggaggagtggatg
cgggccatccagatggttgccaacagcctcaagcagcgggccctgggtgaggaccccatg
gactacaagtgtggctcccccagtgactcctctgtggccgaggagatggaagttgcggtc
agcaaggcacgggccaaagtgaccatgaatgacttcgactatctcaaactccttggcaag
ggaacctttggcaaagtcatcctggtgcgggagaaggccactggccgctactacgccatg
aagatcctgcggaaggaagtcatcattgccaaggatgaagtcgctcacacggtcaccgag
agccgggtcctccagaacaccaggcacccgttcctcactgcgctgaagtatgccttccag
acccacgaccgtctgtgcttcgtgatggagtacgccaacggtggcgagctgttcttccac
ctgtcccgggagcgtgtcttcacagaggagcgggctcggttttatggtgcagagatcgtc
tcagctcttgagtatttgcactctcgggacgtggtgtaccgcgacatcaagctggaaaac
ctcatgctggacaaagacggccacatcaagatcactgacttcggcctctgcaaagaaggc
atcagtgatggggccaccatgaaaaccttctgtgggactccggagtacctggcgcctgag
gtgctggaggacaacgactatggccgggcagtagactggtgggggctgggcgtggtcatg
tacgagatgatgtgtggccgcctgcccttctacaaccaggaccacgagcgcctcttcgag
ctcatcctcatggaggagatccgcttccctcgcacgctcagccccgaggccaagtccctg
cttgccgggctgcttaagaaggaccccaagcagaggcttggtggggggcccagcgatgcc
caggaggtcatggagcacaggttcttcctcagcatcaactggcaggacgtggtccagaag
aagctcctgccacccttcaaacctcaggtcacgtctgaggtcgacacacggtacttcgat
gatgaattcaccgcccagtccatcacaatcacaccccccgaccgctatgacagcctgggc
tccctggagctggaccagcggacccacttcccccagttctcctactcggccagcatccgg
gagtga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100399039Help
Entry
100399039         CDS       T03264                                 

Gene name
AKT3
Definition
(RefSeq) AKT serine/threonine kinase 3
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc01522  Endocrine resistance
cjc01524  Platinum drug resistance
cjc04010  MAPK signaling pathway
cjc04012  ErbB signaling pathway
cjc04014  Ras signaling pathway
cjc04015  Rap1 signaling pathway
cjc04022  cGMP-PKG signaling pathway
cjc04024  cAMP signaling pathway
cjc04062  Chemokine signaling pathway
cjc04066  HIF-1 signaling pathway
cjc04068  FoxO signaling pathway
cjc04071  Sphingolipid signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04140  Autophagy - animal
cjc04150  mTOR signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04152  AMPK signaling pathway
cjc04210  Apoptosis
cjc04211  Longevity regulating pathway
cjc04213  Longevity regulating pathway - multiple species
cjc04218  Cellular senescence
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04370  VEGF signaling pathway
cjc04371  Apelin signaling pathway
cjc04380  Osteoclast differentiation
cjc04510  Focal adhesion
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04611  Platelet activation
cjc04620  Toll-like receptor signaling pathway
cjc04625  C-type lectin receptor signaling pathway
cjc04630  Jak-STAT signaling pathway
cjc04660  T cell receptor signaling pathway
cjc04662  B cell receptor signaling pathway
cjc04664  Fc epsilon RI signaling pathway
cjc04666  Fc gamma R-mediated phagocytosis
cjc04668  TNF signaling pathway
cjc04722  Neurotrophin signaling pathway
cjc04725  Cholinergic synapse
cjc04728  Dopaminergic synapse
cjc04910  Insulin signaling pathway
cjc04914  Progesterone-mediated oocyte maturation
cjc04915  Estrogen signaling pathway
cjc04917  Prolactin signaling pathway
cjc04919  Thyroid hormone signaling pathway
cjc04920  Adipocytokine signaling pathway
cjc04922  Glucagon signaling pathway
cjc04923  Regulation of lipolysis in adipocytes
cjc04926  Relaxin signaling pathway
cjc04931  Insulin resistance
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc04973  Carbohydrate digestion and absorption
cjc05142  Chagas disease (American trypanosomiasis)
cjc05145  Toxoplasmosis
cjc05152  Tuberculosis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05165  Human papillomavirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05210  Colorectal cancer
cjc05211  Renal cell carcinoma
cjc05212  Pancreatic cancer
cjc05213  Endometrial cancer
cjc05214  Glioma
cjc05215  Prostate cancer
cjc05218  Melanoma
cjc05220  Chronic myeloid leukemia
cjc05221  Acute myeloid leukemia
cjc05222  Small cell lung cancer
cjc05223  Non-small cell lung cancer
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
cjc05230  Central carbon metabolism in cancer
cjc05231  Choline metabolism in cancer
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cjc05418  Fluid shear stress and atherosclerosis
Module
cjc_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100399039 (AKT3)
   04015 Rap1 signaling pathway
    100399039 (AKT3)
   04010 MAPK signaling pathway
    100399039 (AKT3)
   04012 ErbB signaling pathway
    100399039 (AKT3)
   04370 VEGF signaling pathway
    100399039 (AKT3)
   04371 Apelin signaling pathway
    100399039 (AKT3)
   04630 Jak-STAT signaling pathway
    100399039 (AKT3)
   04668 TNF signaling pathway
    100399039 (AKT3)
   04066 HIF-1 signaling pathway
    100399039 (AKT3)
   04068 FoxO signaling pathway
    100399039 (AKT3)
   04072 Phospholipase D signaling pathway
    100399039 (AKT3)
   04071 Sphingolipid signaling pathway
    100399039 (AKT3)
   04024 cAMP signaling pathway
    100399039 (AKT3)
   04022 cGMP-PKG signaling pathway
    100399039 (AKT3)
   04151 PI3K-Akt signaling pathway
    100399039 (AKT3)
   04152 AMPK signaling pathway
    100399039 (AKT3)
   04150 mTOR signaling pathway
    100399039 (AKT3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100399039 (AKT3)
  09143 Cell growth and death
   04210 Apoptosis
    100399039 (AKT3)
   04218 Cellular senescence
    100399039 (AKT3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100399039 (AKT3)
   04550 Signaling pathways regulating pluripotency of stem cells
    100399039 (AKT3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100399039 (AKT3)
   04620 Toll-like receptor signaling pathway
    100399039 (AKT3)
   04625 C-type lectin receptor signaling pathway
    100399039 (AKT3)
   04660 T cell receptor signaling pathway
    100399039 (AKT3)
   04662 B cell receptor signaling pathway
    100399039 (AKT3)
   04664 Fc epsilon RI signaling pathway
    100399039 (AKT3)
   04666 Fc gamma R-mediated phagocytosis
    100399039 (AKT3)
   04062 Chemokine signaling pathway
    100399039 (AKT3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100399039 (AKT3)
   04922 Glucagon signaling pathway
    100399039 (AKT3)
   04923 Regulation of lipolysis in adipocytes
    100399039 (AKT3)
   04920 Adipocytokine signaling pathway
    100399039 (AKT3)
   04915 Estrogen signaling pathway
    100399039 (AKT3)
   04914 Progesterone-mediated oocyte maturation
    100399039 (AKT3)
   04917 Prolactin signaling pathway
    100399039 (AKT3)
   04926 Relaxin signaling pathway
    100399039 (AKT3)
   04919 Thyroid hormone signaling pathway
    100399039 (AKT3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100399039 (AKT3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100399039 (AKT3)
  09156 Nervous system
   04725 Cholinergic synapse
    100399039 (AKT3)
   04728 Dopaminergic synapse
    100399039 (AKT3)
   04722 Neurotrophin signaling pathway
    100399039 (AKT3)
  09158 Development
   04380 Osteoclast differentiation
    100399039 (AKT3)
  09149 Aging
   04211 Longevity regulating pathway
    100399039 (AKT3)
   04213 Longevity regulating pathway - multiple species
    100399039 (AKT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100399039 (AKT3)
   05205 Proteoglycans in cancer
    100399039 (AKT3)
   05230 Central carbon metabolism in cancer
    100399039 (AKT3)
   05231 Choline metabolism in cancer
    100399039 (AKT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100399039 (AKT3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100399039 (AKT3)
   05212 Pancreatic cancer
    100399039 (AKT3)
   05225 Hepatocellular carcinoma
    100399039 (AKT3)
   05226 Gastric cancer
    100399039 (AKT3)
   05214 Glioma
    100399039 (AKT3)
   05221 Acute myeloid leukemia
    100399039 (AKT3)
   05220 Chronic myeloid leukemia
    100399039 (AKT3)
   05218 Melanoma
    100399039 (AKT3)
   05211 Renal cell carcinoma
    100399039 (AKT3)
   05215 Prostate cancer
    100399039 (AKT3)
   05213 Endometrial cancer
    100399039 (AKT3)
   05224 Breast cancer
    100399039 (AKT3)
   05222 Small cell lung cancer
    100399039 (AKT3)
   05223 Non-small cell lung cancer
    100399039 (AKT3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100399039 (AKT3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100399039 (AKT3)
   04931 Insulin resistance
    100399039 (AKT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100399039 (AKT3)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100399039 (AKT3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100399039 (AKT3)
   05170 Human immunodeficiency virus 1 infection
    100399039 (AKT3)
   05162 Measles
    100399039 (AKT3)
   05164 Influenza A
    100399039 (AKT3)
   05161 Hepatitis B
    100399039 (AKT3)
   05160 Hepatitis C
    100399039 (AKT3)
   05168 Herpes simplex virus 1 infection
    100399039 (AKT3)
   05163 Human cytomegalovirus infection
    100399039 (AKT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100399039 (AKT3)
   05169 Epstein-Barr virus infection
    100399039 (AKT3)
   05165 Human papillomavirus infection
    100399039 (AKT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100399039 (AKT3)
   05142 Chagas disease (American trypanosomiasis)
    100399039 (AKT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100399039 (AKT3)
   01524 Platinum drug resistance
    100399039 (AKT3)
   01522 Endocrine resistance
    100399039 (AKT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100399039 (AKT3)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100399039 (AKT3)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   100399039 (AKT3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PH Pkinase_C Kinase-like FTA2 PH_11 APH
Motif
Other DBs
NCBI-GeneID: 100399039
NCBI-ProteinID: XP_008983975
Ensembl: ENSCJAG00000017090
UniProt: F7IEX9
Position
19
AA seq 479 aa AA seqDB search
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCMDNERRPHFPQFSYSASGRE
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatgttaccattgtgaaagaaggttgggttcagaagaggggagaatatataaaa
aactggaggccaagatatttccttttgaagacagatggctcattcataggatataaagag
aaacctcaagatgtggatttaccttatcccctcaacaacttttcagtggcaaaatgccag
ttaatgaaaacagaacgaccaaagccaaacacatttataatcagatgtctccagtggacc
actgttatagagagaacatttcatgtagatactccagaggaaagggaagaatggacagaa
gctatccaggctgtagcagacagactacagaggcaagaagaagagagaatgaattgtagt
ccaacttcacaaattgataacataggggaagaagagatggatgcttctacaacccatcat
aaaagaaagacaatgaatgattttgactatttgaaactactaggtaaaggcacttttggg
aaagtcattttggttcgagagaaggcaagtggaaaatactatgctatgaagatcttgaag
aaagaagtcattattgcaaaggatgaagtggcacacacgctaactgaaagcagagtatta
aagaacactagacatccctttttaacatccttgaaatattccttccagacaaaagaccgt
ttgtgttttgtgatggaatatgttaatgggggcgagctgtttttccatttgtcgagagag
cgggtgttctctgaggaccgcacacgtttctatggtgcagaaattgtctctgccttggac
tatctacattccggaaagattgtttaccgtgatcttaagttggagaatctaatgctggat
aaagatggccatataaaaattacagatttcggactttgcaaagaagggatcacagatgca
gccaccatgaagacattctgtggtacaccagaatatctggcaccagaggtgttagaagat
aatgactatggccgagcagtagactggtggggcctcggggttgtcatgtatgaaatgatg
tgtgggaggttacctttctacaaccaggaccatgagaaacttttcgaactcatattaatg
gaagacattaaatttcctcgaacactctcttcagatgcaaaatcattgctttcagggctc
ttgataaaggatccaaataaacgccttggtggaggaccagatgatgcgaaagaaattatg
agacacagtttcttttccggagtaaactggcaagatgtatatgataaaaagcttgtacct
ccttttaaacctcaagtaacatctgagacagatactagatattttgatgaggagtttaca
gctcagactattaccataacaccgcctgaaaaatatgatgaggatggtatggactgcatg
gacaatgagaggcggccacatttccctcaattttcctactctgcaagtggacgagaataa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100404447Help
Entry
100404447         CDS       T03264                                 

Gene name
AKT1
Definition
(RefSeq) AKT serine/threonine kinase 1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc01522  Endocrine resistance
cjc01524  Platinum drug resistance
cjc04010  MAPK signaling pathway
cjc04012  ErbB signaling pathway
cjc04014  Ras signaling pathway
cjc04015  Rap1 signaling pathway
cjc04022  cGMP-PKG signaling pathway
cjc04024  cAMP signaling pathway
cjc04062  Chemokine signaling pathway
cjc04066  HIF-1 signaling pathway
cjc04068  FoxO signaling pathway
cjc04071  Sphingolipid signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04140  Autophagy - animal
cjc04150  mTOR signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04152  AMPK signaling pathway
cjc04210  Apoptosis
cjc04211  Longevity regulating pathway
cjc04213  Longevity regulating pathway - multiple species
cjc04218  Cellular senescence
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04370  VEGF signaling pathway
cjc04371  Apelin signaling pathway
cjc04380  Osteoclast differentiation
cjc04510  Focal adhesion
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04611  Platelet activation
cjc04620  Toll-like receptor signaling pathway
cjc04625  C-type lectin receptor signaling pathway
cjc04630  Jak-STAT signaling pathway
cjc04660  T cell receptor signaling pathway
cjc04662  B cell receptor signaling pathway
cjc04664  Fc epsilon RI signaling pathway
cjc04666  Fc gamma R-mediated phagocytosis
cjc04668  TNF signaling pathway
cjc04722  Neurotrophin signaling pathway
cjc04725  Cholinergic synapse
cjc04728  Dopaminergic synapse
cjc04910  Insulin signaling pathway
cjc04914  Progesterone-mediated oocyte maturation
cjc04915  Estrogen signaling pathway
cjc04917  Prolactin signaling pathway
cjc04919  Thyroid hormone signaling pathway
cjc04920  Adipocytokine signaling pathway
cjc04922  Glucagon signaling pathway
cjc04923  Regulation of lipolysis in adipocytes
cjc04926  Relaxin signaling pathway
cjc04931  Insulin resistance
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc04973  Carbohydrate digestion and absorption
cjc05142  Chagas disease (American trypanosomiasis)
cjc05145  Toxoplasmosis
cjc05152  Tuberculosis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05165  Human papillomavirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05210  Colorectal cancer
cjc05211  Renal cell carcinoma
cjc05212  Pancreatic cancer
cjc05213  Endometrial cancer
cjc05214  Glioma
cjc05215  Prostate cancer
cjc05218  Melanoma
cjc05220  Chronic myeloid leukemia
cjc05221  Acute myeloid leukemia
cjc05222  Small cell lung cancer
cjc05223  Non-small cell lung cancer
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
cjc05230  Central carbon metabolism in cancer
cjc05231  Choline metabolism in cancer
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cjc05418  Fluid shear stress and atherosclerosis
Module
cjc_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100404447 (AKT1)
   04015 Rap1 signaling pathway
    100404447 (AKT1)
   04010 MAPK signaling pathway
    100404447 (AKT1)
   04012 ErbB signaling pathway
    100404447 (AKT1)
   04370 VEGF signaling pathway
    100404447 (AKT1)
   04371 Apelin signaling pathway
    100404447 (AKT1)
   04630 Jak-STAT signaling pathway
    100404447 (AKT1)
   04668 TNF signaling pathway
    100404447 (AKT1)
   04066 HIF-1 signaling pathway
    100404447 (AKT1)
   04068 FoxO signaling pathway
    100404447 (AKT1)
   04072 Phospholipase D signaling pathway
    100404447 (AKT1)
   04071 Sphingolipid signaling pathway
    100404447 (AKT1)
   04024 cAMP signaling pathway
    100404447 (AKT1)
   04022 cGMP-PKG signaling pathway
    100404447 (AKT1)
   04151 PI3K-Akt signaling pathway
    100404447 (AKT1)
   04152 AMPK signaling pathway
    100404447 (AKT1)
   04150 mTOR signaling pathway
    100404447 (AKT1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100404447 (AKT1)
  09143 Cell growth and death
   04210 Apoptosis
    100404447 (AKT1)
   04218 Cellular senescence
    100404447 (AKT1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100404447 (AKT1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100404447 (AKT1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100404447 (AKT1)
   04620 Toll-like receptor signaling pathway
    100404447 (AKT1)
   04625 C-type lectin receptor signaling pathway
    100404447 (AKT1)
   04660 T cell receptor signaling pathway
    100404447 (AKT1)
   04662 B cell receptor signaling pathway
    100404447 (AKT1)
   04664 Fc epsilon RI signaling pathway
    100404447 (AKT1)
   04666 Fc gamma R-mediated phagocytosis
    100404447 (AKT1)
   04062 Chemokine signaling pathway
    100404447 (AKT1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100404447 (AKT1)
   04922 Glucagon signaling pathway
    100404447 (AKT1)
   04923 Regulation of lipolysis in adipocytes
    100404447 (AKT1)
   04920 Adipocytokine signaling pathway
    100404447 (AKT1)
   04915 Estrogen signaling pathway
    100404447 (AKT1)
   04914 Progesterone-mediated oocyte maturation
    100404447 (AKT1)
   04917 Prolactin signaling pathway
    100404447 (AKT1)
   04926 Relaxin signaling pathway
    100404447 (AKT1)
   04919 Thyroid hormone signaling pathway
    100404447 (AKT1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100404447 (AKT1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100404447 (AKT1)
  09156 Nervous system
   04725 Cholinergic synapse
    100404447 (AKT1)
   04728 Dopaminergic synapse
    100404447 (AKT1)
   04722 Neurotrophin signaling pathway
    100404447 (AKT1)
  09158 Development
   04380 Osteoclast differentiation
    100404447 (AKT1)
  09149 Aging
   04211 Longevity regulating pathway
    100404447 (AKT1)
   04213 Longevity regulating pathway - multiple species
    100404447 (AKT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100404447 (AKT1)
   05205 Proteoglycans in cancer
    100404447 (AKT1)
   05230 Central carbon metabolism in cancer
    100404447 (AKT1)
   05231 Choline metabolism in cancer
    100404447 (AKT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100404447 (AKT1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100404447 (AKT1)
   05212 Pancreatic cancer
    100404447 (AKT1)
   05225 Hepatocellular carcinoma
    100404447 (AKT1)
   05226 Gastric cancer
    100404447 (AKT1)
   05214 Glioma
    100404447 (AKT1)
   05221 Acute myeloid leukemia
    100404447 (AKT1)
   05220 Chronic myeloid leukemia
    100404447 (AKT1)
   05218 Melanoma
    100404447 (AKT1)
   05211 Renal cell carcinoma
    100404447 (AKT1)
   05215 Prostate cancer
    100404447 (AKT1)
   05213 Endometrial cancer
    100404447 (AKT1)
   05224 Breast cancer
    100404447 (AKT1)
   05222 Small cell lung cancer
    100404447 (AKT1)
   05223 Non-small cell lung cancer
    100404447 (AKT1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100404447 (AKT1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100404447 (AKT1)
   04931 Insulin resistance
    100404447 (AKT1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100404447 (AKT1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100404447 (AKT1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100404447 (AKT1)
   05170 Human immunodeficiency virus 1 infection
    100404447 (AKT1)
   05162 Measles
    100404447 (AKT1)
   05164 Influenza A
    100404447 (AKT1)
   05161 Hepatitis B
    100404447 (AKT1)
   05160 Hepatitis C
    100404447 (AKT1)
   05168 Herpes simplex virus 1 infection
    100404447 (AKT1)
   05163 Human cytomegalovirus infection
    100404447 (AKT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100404447 (AKT1)
   05169 Epstein-Barr virus infection
    100404447 (AKT1)
   05165 Human papillomavirus infection
    100404447 (AKT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100404447 (AKT1)
   05142 Chagas disease (American trypanosomiasis)
    100404447 (AKT1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100404447 (AKT1)
   01524 Platinum drug resistance
    100404447 (AKT1)
   01522 Endocrine resistance
    100404447 (AKT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100404447 (AKT1)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100404447 (AKT1)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   100404447 (AKT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7 APH
Motif
Other DBs
NCBI-GeneID: 100404447
NCBI-ProteinID: XP_017832858
Position
10
AA seq 480 aa AA seqDB search
MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEMMDF
RSGSPSDNSGAEEMEVSLAKPRHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGGTMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIAWQHVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgtggctattgtgaaggagggttggctgcacaaacgaggggagtacatcaag
acttggcggccacggtacttcctcctcaagaatgacggcaccttcattggctacaaagag
cggccgcaggacgtggaccaacgcgaggcccccctcaacaacttctctgtggcacagtgc
cagctgatgaagacggagcggccccggcccaacaccttcatcatccgctgcctgcagtgg
accaccgtcatcgagcgcaccttccacgtggagacgcctgaggagcgggaggagtggaca
actgccatccagacagtggctgatggacttaaaaagcaagaggaggagatgatggacttc
cggtcaggctcacccagtgacaactcgggggctgaagagatggaggtgtcgctggccaag
cccaggcaccgagtgaccatgaatgagtttgagtacctgaagctgctgggcaagggcact
ttcgggaaggtgatcctggtgaaggagaaggccacgggccgctactacgccatgaagatc
ctcaagaaggaggtcatcgtggccaaggacgaggtggcccacacactcactgagaacaga
gtcctgcagaactccaggcaccccttcctcacggccctgaagtattccttccagacccac
gaccgcctctgcttcgtcatggagtacgccaatggcggcgagctcttcttccacctgtcc
cgtgagcgtgtgttctccgaggaccgggcccgcttctatggcgccgagatcgtgtcagcc
ctggactacctgcactcggagaagaacgtggtgtaccgggacctcaagctggagaacctc
atgctggacaaggacgggcacatcaagatcacagacttcgggctgtgtaaggaggggatc
aaggacggtggcaccatgaagaccttctgcggcactcctgagtacctggcccccgaggtg
ctggaggacaatgactacggccgcgcggtggactggtgggggctgggcgtggtcatgtac
gagatgatgtgtggccgcctgcccttctacaaccaggaccacgagaagctctttgagctc
atcctcatggaggagatccgcttcccacgcacgctcggccctgaggccaagtctttgctg
tcagggctgctgaagaaggaccccaagcagaggctgggtgggggctccgaggacgccaag
gagatcatgcagcaccgcttctttgccggcattgcgtggcagcacgtgtacgagaagaag
ctcagcccgcccttcaagccccaggtcacatcggagactgacaccaggtattttgatgag
gagttcacagcccagatgatcaccatcacaccacctgaccaagacgacagcatggagtgt
gtggacagcgagcgcaggccccacttcccccagttctcctactcagccagcggcacggcc
tga

DBGET integrated database retrieval system