KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100388086Help
Entry
100388086         CDS       T03264                                 

Gene name
ALOX15
Definition
(RefSeq) arachidonate 15-lipoxygenase
  KO
K00460  arachidonate 15-lipoxygenase [EC:1.13.11.33]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00590  Arachidonic acid metabolism
cjc00591  Linoleic acid metabolism
cjc01100  Metabolic pathways
cjc04216  Ferroptosis
cjc04217  Necroptosis
cjc04726  Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    100388086 (ALOX15)
   00591 Linoleic acid metabolism
    100388086 (ALOX15)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    100388086 (ALOX15)
   04217 Necroptosis
    100388086 (ALOX15)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    100388086 (ALOX15)
Enzymes [BR:cjc01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.33  arachidonate 15-lipoxygenase
     100388086 (ALOX15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipoxygenase PLAT
Motif
Other DBs
NCBI-GeneID: 100388086
NCBI-ProteinID: XP_008994665
Ensembl: ENSCJAG00000020615
Position
5
AA seq 663 aa AA seqDB search
MGLYRVRVSTGASLCAGSNNQVQLWLVGQHGEAALGTRLRPARGKVTEVKVEVPEYLGPL
LFVKLRKRHLLQDDAWFCSWISVQGPGAAGEEVRFPCYRWVEGDGVLSLPEGTGRTVFDD
PQGLFRKLREEELEERRKRYRWGSWKDGLILNMAGAKLSDLPVDERFLEDKRVDFEASLA
KGLADLAIKDTFNVLTCWKDLDDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPM
VLRRSSCLPARLVFPPGMEELQAQLQKELEGGTLFEADFSLLDGIKANVILCSQQHLAAP
LVMLKLQPDGKLLPMVIQLQLPSTGTPPPLLFLPTDPPMVWLLAKCWVRSSDFQLHELQS
HLLRGHLMAEVIAVATMRCLPSIHPVFKLLIPHLRYTLEINIRARTGLVSDMGVFDQVVS
TGGGGHLELLKRAGAFLTYSSFCPPDDLADRGLLEVKSSFYAQDALRLWETISRYVEGIM
SLHYXTHVAVKGDTELQTWCWEIAEIGLLGAQDRGFPVSLQSQEQLCHFLTMCIFTCTGQ
HSSVHLGQLDWYTWVPNAPCTMRLPPPTTKDATVETVMATLPNFHQASLQMSITWQLGRR
QPIMVAVGQHEEEYFSGPEPKAVLRKFREELAALDKEIETRNAKLDMPYEYLRPSLVENS
VAI
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgggtctctaccgcgtccgcgtgtccactggggcctcgctctgtgcgggctccaacaac
caggtgcaactgtggctggtcggccagcacggggaggcggcgctcgggacgcgactgcgg
cctgcacggggcaaggtgacggaagtcaaggtggaagtgcccgagtacctggggccgctg
ctgttcgtgaaactgcgcaaaagacacctcctccaggacgacgcctggttctgcagctgg
atctccgtgcagggccccggggccgcgggggaggaagtcaggttcccttgttaccgctgg
gtggagggcgacggcgtcctgagcctgcctgaaggcaccggccgcactgtgttcgacgac
cctcaaggcctgttcaggaagctccgggaagaggagctggaagagagaaggaagcggtac
cggtggggaagctggaaggatgggctgattctgaatatggctggggccaaactgagtgac
ctccctgtggatgagcgatttctggaagacaagagagtcgactttgaggcttcgctggcc
aaggggctggcggacctcgctatcaaagacactttcaacgttctgacttgctggaaggat
ctggatgacttcaaccggattttctggtgtggccagagcaagctggcagagcgtgtgcgg
gactcctggaaggaagatgccttgtttgggtaccagtttcttaatggcgccaaccccatg
gtgctgaggcgctccagttgccttcccgctcgccttgtgttccctccagggatggaggaa
ctgcaggcccagctgcagaaggagttggagggaggcacactgtttgaagctgacttctcc
ctgctggatgggatcaaggccaatgtcattctgtgtagtcagcagcacctggctgcacct
ctggtcatgctgaaactgcagcctgatgggaaactcttgcccatggtcatccagcttcaa
ctgcccagcacaggaaccccgccacctctgctcttcttgcccacggatcctccaatggtc
tggcttctggccaaatgctgggtccgcagctctgacttccaactccacgagctgcagtct
catcttctgaggggacacttgatggctgaggtcattgctgtggccaccatgaggtgcctt
ccatcaatacatcctgtcttcaagcttctaattccccacctgcgatacaccctggaaatt
aacatccgggccaggactggactggtctctgacatgggagttttcgatcaggtggtaagc
accggtgggggaggccacctggagctgctcaagcgagctggagcctttctgacctatagc
tccttctgtcccccggatgacttggctgaccgggggctcctggaagtgaagtcttccttc
tatgcccaagatgccctgcggctctgggaaaccatctctcggtacgtggaaggaatcatg
agtctccactatnngacacacgtggctgtgaaaggtgacactgagctgcagacctggtgt
tgggagatcgctgaaattgggctgctaggggcccaggatcgagggtttcctgtctcttta
cagtctcaggaacagctctgccactttctcaccatgtgcatcttcacctgcacgggtcaa
cactcctctgtccacctgggccagctggactggtacacttgggttcctaatgcaccctgc
acgatgcggttgcccccgccaaccaccaaggatgcgacagtggagacggtgatggcaaca
ctgcccaacttccaccaagcttctctccagatgtccatcacttggcagctgggcagacgc
cagcccattatggtggctgtgggccagcatgaggaggagtatttttcgggccctgagcct
aaggctgtgctgaggaagttcagggaggagctagctgcccttgataaggaaatcgagacc
cggaatgcaaagctggacatgccctatgaatacctgcggcccagcctggtggaaaacagt
gtggccatctga

DBGET integrated database retrieval system