KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100388113Help
Entry
100388113         CDS       T03264                                 

Gene name
GNAI1
Definition
(RefSeq) G protein subunit alpha i1
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04015  Rap1 signaling pathway
cjc04022  cGMP-PKG signaling pathway
cjc04024  cAMP signaling pathway
cjc04062  Chemokine signaling pathway
cjc04071  Sphingolipid signaling pathway
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04360  Axon guidance
cjc04371  Apelin signaling pathway
cjc04540  Gap junction
cjc04611  Platelet activation
cjc04670  Leukocyte transendothelial migration
cjc04713  Circadian entrainment
cjc04723  Retrograde endocannabinoid signaling
cjc04724  Glutamatergic synapse
cjc04725  Cholinergic synapse
cjc04726  Serotonergic synapse
cjc04727  GABAergic synapse
cjc04728  Dopaminergic synapse
cjc04730  Long-term depression
cjc04914  Progesterone-mediated oocyte maturation
cjc04915  Estrogen signaling pathway
cjc04916  Melanogenesis
cjc04921  Oxytocin signaling pathway
cjc04923  Regulation of lipolysis in adipocytes
cjc04924  Renin secretion
cjc04926  Relaxin signaling pathway
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04934  Cushing syndrome
cjc04971  Gastric acid secretion
cjc05012  Parkinson disease
cjc05030  Cocaine addiction
cjc05032  Morphine addiction
cjc05034  Alcoholism
cjc05133  Pertussis
cjc05142  Chagas disease (American trypanosomiasis)
cjc05145  Toxoplasmosis
cjc05163  Human cytomegalovirus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
Module
cjc_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100388113 (GNAI1)
   04371 Apelin signaling pathway
    100388113 (GNAI1)
   04071 Sphingolipid signaling pathway
    100388113 (GNAI1)
   04024 cAMP signaling pathway
    100388113 (GNAI1)
   04022 cGMP-PKG signaling pathway
    100388113 (GNAI1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100388113 (GNAI1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100388113 (GNAI1)
   04670 Leukocyte transendothelial migration
    100388113 (GNAI1)
   04062 Chemokine signaling pathway
    100388113 (GNAI1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100388113 (GNAI1)
   04915 Estrogen signaling pathway
    100388113 (GNAI1)
   04914 Progesterone-mediated oocyte maturation
    100388113 (GNAI1)
   04921 Oxytocin signaling pathway
    100388113 (GNAI1)
   04926 Relaxin signaling pathway
    100388113 (GNAI1)
   04928 Parathyroid hormone synthesis, secretion and action
    100388113 (GNAI1)
   04916 Melanogenesis
    100388113 (GNAI1)
   04924 Renin secretion
    100388113 (GNAI1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100388113 (GNAI1)
  09154 Digestive system
   04971 Gastric acid secretion
    100388113 (GNAI1)
  09156 Nervous system
   04724 Glutamatergic synapse
    100388113 (GNAI1)
   04727 GABAergic synapse
    100388113 (GNAI1)
   04725 Cholinergic synapse
    100388113 (GNAI1)
   04728 Dopaminergic synapse
    100388113 (GNAI1)
   04726 Serotonergic synapse
    100388113 (GNAI1)
   04730 Long-term depression
    100388113 (GNAI1)
   04723 Retrograde endocannabinoid signaling
    100388113 (GNAI1)
  09158 Development
   04360 Axon guidance
    100388113 (GNAI1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100388113 (GNAI1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100388113 (GNAI1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100388113 (GNAI1)
  09165 Substance dependence
   05030 Cocaine addiction
    100388113 (GNAI1)
   05032 Morphine addiction
    100388113 (GNAI1)
   05034 Alcoholism
    100388113 (GNAI1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100388113 (GNAI1)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100388113 (GNAI1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100388113 (GNAI1)
   05163 Human cytomegalovirus infection
    100388113 (GNAI1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100388113 (GNAI1)
   05142 Chagas disease (American trypanosomiasis)
    100388113 (GNAI1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100388113 (GNAI1)
   04031 GTP-binding proteins [BR:cjc04031]
    100388113 (GNAI1)
Exosome [BR:cjc04147]
 Exosomal proteins
  Proteins found in most exosomes
   100388113 (GNAI1)
GTP-binding proteins [BR:cjc04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    100388113 (GNAI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_16 AAA_29 FtsK_SpoIIIE
Motif
Other DBs
NCBI-GeneID: 100388113
NCBI-ProteinID: XP_002751707
Ensembl: ENSCJAG00000003237
UniProt: F7IEH0
Position
8
AA seq 354 aa AA seqDB search
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAG
YSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMT
AELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVK
TTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYSGSNTYEEAA
AYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgggctgcacgctgagcgccgaggacaaggcggcggtggagcggagtaagatgatcgac
cgcaacctccgcgaggacggagagaaggctgcgcgcgaggtcaagctgctgctgctcggc
gctggtgaatctggtaagagtacaattgtgaagcagatgaaaattatccacgaagctggt
tattcagaagaggagtgtaaacaatacaaagcagtggtttacagtaacaccatccagtca
attattgctatcatcagggctatggggaggttgaagatagactttggtgactcagcccgg
gcggatgatgcgcgccaactctttgtgctagctggagctgctgaagaaggctttatgact
gcagaacttgctggagttataaagagattgtggaaagatagtggtgtacaagcctgtttc
aacagatcccgagagtaccagctcaatgattctgcagcatactatttgaatgacttggac
agaatagctcaaccaaattatatcccgactcaacaagatgttcttagaactagagtgaaa
actacaggaattgttgaaacccattttactttcaaagatcttcattttaaaatgtttgat
gtgggaggtcagcgatctgagcggaagaagtggattcattgcttcgaaggagtgacagcg
atcatcttctgtgtagcactgagtgactatgacctggttctagctgaagatgaagaaatg
aatcgaatgcatgaaagcatgaagttgttcgacagcatatgtaacaacaagtggtttaca
gatacatctattatactttttctaaacaagaaggatctctttgaagaaaaaatcaaaaag
agccctctcactatatgctatccggaatattcaggatcaaacacatatgaagaggcagct
gcatatattcaatgtcagtttgaagacctcaataaaagaaaggacacaaaggaaatttac
acccacttcacatgtgccacagatactaagaatgtgcagtttgtttttgatgctgtaaca
gatgtcatcataaaaaataatctaaaagattgtggtctcttctaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100404474Help
Entry
100404474         CDS       T03264                                 

Gene name
GNAI2
Definition
(RefSeq) G protein subunit alpha i2
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04015  Rap1 signaling pathway
cjc04022  cGMP-PKG signaling pathway
cjc04024  cAMP signaling pathway
cjc04062  Chemokine signaling pathway
cjc04071  Sphingolipid signaling pathway
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04360  Axon guidance
cjc04371  Apelin signaling pathway
cjc04540  Gap junction
cjc04611  Platelet activation
cjc04670  Leukocyte transendothelial migration
cjc04713  Circadian entrainment
cjc04723  Retrograde endocannabinoid signaling
cjc04724  Glutamatergic synapse
cjc04725  Cholinergic synapse
cjc04726  Serotonergic synapse
cjc04727  GABAergic synapse
cjc04728  Dopaminergic synapse
cjc04730  Long-term depression
cjc04914  Progesterone-mediated oocyte maturation
cjc04915  Estrogen signaling pathway
cjc04916  Melanogenesis
cjc04921  Oxytocin signaling pathway
cjc04923  Regulation of lipolysis in adipocytes
cjc04924  Renin secretion
cjc04926  Relaxin signaling pathway
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04934  Cushing syndrome
cjc04971  Gastric acid secretion
cjc05012  Parkinson disease
cjc05030  Cocaine addiction
cjc05032  Morphine addiction
cjc05034  Alcoholism
cjc05133  Pertussis
cjc05142  Chagas disease (American trypanosomiasis)
cjc05145  Toxoplasmosis
cjc05163  Human cytomegalovirus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
Module
cjc_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100404474 (GNAI2)
   04371 Apelin signaling pathway
    100404474 (GNAI2)
   04071 Sphingolipid signaling pathway
    100404474 (GNAI2)
   04024 cAMP signaling pathway
    100404474 (GNAI2)
   04022 cGMP-PKG signaling pathway
    100404474 (GNAI2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100404474 (GNAI2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100404474 (GNAI2)
   04670 Leukocyte transendothelial migration
    100404474 (GNAI2)
   04062 Chemokine signaling pathway
    100404474 (GNAI2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100404474 (GNAI2)
   04915 Estrogen signaling pathway
    100404474 (GNAI2)
   04914 Progesterone-mediated oocyte maturation
    100404474 (GNAI2)
   04921 Oxytocin signaling pathway
    100404474 (GNAI2)
   04926 Relaxin signaling pathway
    100404474 (GNAI2)
   04928 Parathyroid hormone synthesis, secretion and action
    100404474 (GNAI2)
   04916 Melanogenesis
    100404474 (GNAI2)
   04924 Renin secretion
    100404474 (GNAI2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100404474 (GNAI2)
  09154 Digestive system
   04971 Gastric acid secretion
    100404474 (GNAI2)
  09156 Nervous system
   04724 Glutamatergic synapse
    100404474 (GNAI2)
   04727 GABAergic synapse
    100404474 (GNAI2)
   04725 Cholinergic synapse
    100404474 (GNAI2)
   04728 Dopaminergic synapse
    100404474 (GNAI2)
   04726 Serotonergic synapse
    100404474 (GNAI2)
   04730 Long-term depression
    100404474 (GNAI2)
   04723 Retrograde endocannabinoid signaling
    100404474 (GNAI2)
  09158 Development
   04360 Axon guidance
    100404474 (GNAI2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100404474 (GNAI2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100404474 (GNAI2)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100404474 (GNAI2)
  09165 Substance dependence
   05030 Cocaine addiction
    100404474 (GNAI2)
   05032 Morphine addiction
    100404474 (GNAI2)
   05034 Alcoholism
    100404474 (GNAI2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100404474 (GNAI2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100404474 (GNAI2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100404474 (GNAI2)
   05163 Human cytomegalovirus infection
    100404474 (GNAI2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100404474 (GNAI2)
   05142 Chagas disease (American trypanosomiasis)
    100404474 (GNAI2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100404474 (GNAI2)
   04031 GTP-binding proteins [BR:cjc04031]
    100404474 (GNAI2)
Exosome [BR:cjc04147]
 Exosomal proteins
  Proteins found in most exosomes
   100404474 (GNAI2)
GTP-binding proteins [BR:cjc04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    100404474 (GNAI2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc AAA_16 TniB AAA_29
Motif
Other DBs
NCBI-GeneID: 100404474
NCBI-ProteinID: XP_002758420
Ensembl: ENSCJAG00000004925
UniProt: F6ZZK3
Position
15
AA seq 355 aa AA seqDB search
MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEEECRQYRAVVYSNTIQSIMAIVKAMGNLQIDFADPSRADDARQLFALSCTAEEQGVL
PDDLSGVIRRLWADHGVQACFGRSREYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRV
KTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEE
MNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKITHSPLVICFPEYTGANKYDEA
ASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggggtgcaccgtgagcgccgaggacaaggcggcggccgagcgctctaagatgatcgac
aagaacctgcgggaagacggcgagaaggcggcgcgggaggtgaagttgctgctgttgggt
gctggggagtcagggaagagcaccatcgtcaagcagatgaagatcatccacgaggacggc
tactccgaggaggaatgccggcagtaccgggcagttgtctacagcaacaccatccagtcc
atcatggccattgtcaaggccatgggcaacctgcagatcgacttcgctgacccctccaga
gcggacgatgccaggcagctgtttgcactgtcctgcactgctgaggagcagggcgtgctc
cctgatgacctgtccggcgtcatccggaggctctgggctgaccatggtgtgcaggcctgc
tttggccgctcgagggaataccagctcaacgactcagctgcctactacctgaatgacctg
gagcgcattgcacagagtgactacatccccacacagcaagatgtgctacggacccgcgta
aagaccacagggatcgtggagacacacttcaccttcaaggacttacacttcaagatgttt
gatgtgggtggtcagcggtctgagcgaaagaagtggatccactgctttgagggcgtcaca
gccatcatcttctgcgtagcattgagcgcctatgacttggtgctagctgaggacgaggag
atgaaccgcatgcatgagagcatgaaactattcgacagcatctgcaacaacaagtggttc
acagacacgtccatcatcctcttcctcaacaagaaggacctgttcgaggagaagatcaca
cacagtcccctggtcatctgcttccctgagtacacaggggccaacaagtatgatgaggca
gccagctacatccagagtaagtttgaggacctgaataagcgcaaagacaccaaggagatc
tacacgcacttcacgtgcgccaccgacaccaagaacgtgcagtttgtgtttgacgcagtc
actgacgtcattatcaagaacaacctgaaggactgcggcctcttctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100405745Help
Entry
100405745         CDS       T03264                                 

Gene name
GNAI3
Definition
(RefSeq) G protein subunit alpha i3
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04015  Rap1 signaling pathway
cjc04022  cGMP-PKG signaling pathway
cjc04024  cAMP signaling pathway
cjc04062  Chemokine signaling pathway
cjc04071  Sphingolipid signaling pathway
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04360  Axon guidance
cjc04371  Apelin signaling pathway
cjc04540  Gap junction
cjc04611  Platelet activation
cjc04670  Leukocyte transendothelial migration
cjc04713  Circadian entrainment
cjc04723  Retrograde endocannabinoid signaling
cjc04724  Glutamatergic synapse
cjc04725  Cholinergic synapse
cjc04726  Serotonergic synapse
cjc04727  GABAergic synapse
cjc04728  Dopaminergic synapse
cjc04730  Long-term depression
cjc04914  Progesterone-mediated oocyte maturation
cjc04915  Estrogen signaling pathway
cjc04916  Melanogenesis
cjc04921  Oxytocin signaling pathway
cjc04923  Regulation of lipolysis in adipocytes
cjc04924  Renin secretion
cjc04926  Relaxin signaling pathway
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04934  Cushing syndrome
cjc04971  Gastric acid secretion
cjc05012  Parkinson disease
cjc05030  Cocaine addiction
cjc05032  Morphine addiction
cjc05034  Alcoholism
cjc05133  Pertussis
cjc05142  Chagas disease (American trypanosomiasis)
cjc05145  Toxoplasmosis
cjc05163  Human cytomegalovirus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
Module
cjc_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100405745 (GNAI3)
   04371 Apelin signaling pathway
    100405745 (GNAI3)
   04071 Sphingolipid signaling pathway
    100405745 (GNAI3)
   04024 cAMP signaling pathway
    100405745 (GNAI3)
   04022 cGMP-PKG signaling pathway
    100405745 (GNAI3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100405745 (GNAI3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100405745 (GNAI3)
   04670 Leukocyte transendothelial migration
    100405745 (GNAI3)
   04062 Chemokine signaling pathway
    100405745 (GNAI3)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100405745 (GNAI3)
   04915 Estrogen signaling pathway
    100405745 (GNAI3)
   04914 Progesterone-mediated oocyte maturation
    100405745 (GNAI3)
   04921 Oxytocin signaling pathway
    100405745 (GNAI3)
   04926 Relaxin signaling pathway
    100405745 (GNAI3)
   04928 Parathyroid hormone synthesis, secretion and action
    100405745 (GNAI3)
   04916 Melanogenesis
    100405745 (GNAI3)
   04924 Renin secretion
    100405745 (GNAI3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100405745 (GNAI3)
  09154 Digestive system
   04971 Gastric acid secretion
    100405745 (GNAI3)
  09156 Nervous system
   04724 Glutamatergic synapse
    100405745 (GNAI3)
   04727 GABAergic synapse
    100405745 (GNAI3)
   04725 Cholinergic synapse
    100405745 (GNAI3)
   04728 Dopaminergic synapse
    100405745 (GNAI3)
   04726 Serotonergic synapse
    100405745 (GNAI3)
   04730 Long-term depression
    100405745 (GNAI3)
   04723 Retrograde endocannabinoid signaling
    100405745 (GNAI3)
  09158 Development
   04360 Axon guidance
    100405745 (GNAI3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100405745 (GNAI3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100405745 (GNAI3)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100405745 (GNAI3)
  09165 Substance dependence
   05030 Cocaine addiction
    100405745 (GNAI3)
   05032 Morphine addiction
    100405745 (GNAI3)
   05034 Alcoholism
    100405745 (GNAI3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100405745 (GNAI3)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100405745 (GNAI3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100405745 (GNAI3)
   05163 Human cytomegalovirus infection
    100405745 (GNAI3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100405745 (GNAI3)
   05142 Chagas disease (American trypanosomiasis)
    100405745 (GNAI3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100405745 (GNAI3)
   04031 GTP-binding proteins [BR:cjc04031]
    100405745 (GNAI3)
Exosome [BR:cjc04147]
 Exosomal proteins
  Proteins found in most exosomes
   100405745 (GNAI3)
GTP-binding proteins [BR:cjc04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    100405745 (GNAI3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA TniB AAA_29 AAA_16
Motif
Other DBs
NCBI-GeneID: 100405745
NCBI-ProteinID: XP_017830489
Ensembl: ENSCJAG00000003054
Position
7
AA seq 361 aa AA seqDB search
MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQVYRATHRLLLLGAGESGKSTIVKQM
KIIHEDGYSEDECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGETARADDARQLFVLAGS
AEEGVMTPELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRISQSNYIPTQQD
VLRTRVKTTGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLV
LAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKRSPLTICYPEYTGS
NTYEEAAAYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKECGL
Y
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgggctgtctcgggaacagtaagaccgaggaccagcgcaacgaggagaaggcgcagcgc
gaggccaacaaaaagatcgagaagcagctgcagaaggacaagcaggtctaccgggccacg
caccgcctgctgctgctgggtgctggagaatctggtaaaagcaccattgtgaaacagatg
aaaatcattcatgaggatggctattcagaggatgaatgtaaacaatataaagtagttgtc
tacagcaatactatacagtccatcattgcaatcatcagagccatgggacggctaaagatt
gactttggggaaactgccagggcagatgatgcccgacaattatttgttttagctggcagt
gctgaagaaggagtcatgactccagaactagcaggagtgattaaacggttgtggcgagat
ggtggggtacaagcttgcttcagcagatccagggaatatcagctcaatgattctgcttca
tattacctaaatgatctggatagaatatcccaatctaactacattccaactcagcaagat
gttcttcggacaagagtgaagaccacgggcattgtagaaacgcatttcaccttcaaagac
ctatacttcaagatgtttgatgtaggtggccaaagatcagaacgaaaaaagtggattcac
tgttttgagggagtgacagcaattatcttctgtgtggccctcagtgattatgaccttgtt
ctggctgaggatgaggagatgaaccgaatgcatgaaagcatgaaactgtttgacagcatt
tgtaataacaaatggtttacagacacttcgatcattctcttccttaacaagaaagacctt
tttgaggaaaaaataaagaggagtccattaactatctgttacccggaatacacaggttcc
aatacatatgaagaggcagctgcctatattcaatgccagtttgaagatctgaacagaaga
aaagataccaaggagatctatactcacttcacctgtgccacagacacgaagaatgtgcag
tttgtttttgatgctgttacagatgtcatcattaaaaacaacttaaaggaatgtggcctt
tattga

DBGET integrated database retrieval system