KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100388186Help
Entry
100388186         CDS       T03264                                 

Gene name
BRCA1
Definition
(RefSeq) BRCA1, DNA repair associated
  KO
K10605  breast cancer type 1 susceptibility protein [EC:2.3.2.27]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01524  Platinum drug resistance
cjc03440  Homologous recombination
cjc03460  Fanconi anemia pathway
cjc04120  Ubiquitin mediated proteolysis
cjc04151  PI3K-Akt signaling pathway
cjc05206  MicroRNAs in cancer
cjc05224  Breast cancer
Module
cjc_M00295  BRCA1-associated genome surveillance complex (BASC)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100388186 (BRCA1)
  09124 Replication and repair
   03440 Homologous recombination
    100388186 (BRCA1)
   03460 Fanconi anemia pathway
    100388186 (BRCA1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100388186 (BRCA1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100388186 (BRCA1)
  09162 Cancer: specific types
   05224 Breast cancer
    100388186 (BRCA1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100388186 (BRCA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cjc01009]
    100388186 (BRCA1)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cjc04121]
    100388186 (BRCA1)
   03036 Chromosome and associated proteins [BR:cjc03036]
    100388186 (BRCA1)
   03400 DNA repair and recombination proteins [BR:cjc03400]
    100388186 (BRCA1)
Enzymes [BR:cjc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100388186 (BRCA1)
Protein phosphatases and associated proteins [BR:cjc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100388186 (BRCA1)
Ubiquitin system [BR:cjc04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    100388186 (BRCA1)
  Multi subunit Ring-finger type E3
   BRCC complex
    100388186 (BRCA1)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     100388186 (BRCA1)
DNA repair and recombination proteins [BR:cjc03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA1-A complex
     100388186 (BRCA1)
    BRCA1-B complex
     100388186 (BRCA1)
    BRCA1-C complex
     100388186 (BRCA1)
    BRCA complex
     100388186 (BRCA1)
   FA (Fanconi anemia) pathway
    Downstream FA components
     100388186 (BRCA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BRCT_assoc BRCT zf-C3HC4 zf-C3HC4_2 zf-C3HC4_4 zf-C3HC4_3 zf-RING_UBOX zf-RING_2 zf-RING_5 BRCT_2 zf-RING_6 zf-Nse Prok-RING_4 zf-ANAPC11 zf-RING_10 zf-rbx1
Motif
Other DBs
NCBI-GeneID: 100388186
NCBI-ProteinID: XP_002748065
Ensembl: ENSCJAG00000012938
Position
5
AA seq 1857 aa AA seqDB search
MDLSAVHVEEVQNVLNAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQ
CPLCKNDITKRSLQESTRFSQLVEELLKIIHAFELDTGLQFANSYNFAKKENNSPEHLKD
EFSIIQSMGYRNRAKRLRQSEPQNPTLQETNLSVQLSNPGIVRSLRTKQWIQPQNKSVYI
DLGSDSSEDTINKKTYCSVGDQELLQITPQGTRDETSLDSAKKAPCEFSEKDITNTEHHQ
SSSNNLNTTEKHATERHPEKYQSSSVSNLHVEPCGTNTHASSLWHENSSLLLTKDRLNVE
KAEFCNKSKQPGLARSQHNRWAESEETCNDRQTPSTEKKVDLDADPLHGRKEWNEQKPPC
SEKPRDDTEDVAWLTLNSSIQKVNEWFSRSDELLTSDDSHDEGSESNAKVAEALEVLNEV
DGYSSSSEKIDLLASDPHDALICKSERVHCKSVESSIEDKIFGKTYRRKASLPNLSHVTE
NLIIGAFVTEPQITQEHPLTNKLKRKRRVTSGLHPEDFIKKADLAVQKTPEKINQGTNQM
ERNDQVMNITNSGHENKTKGDSIQNENNPNPVESLEKESFRSKAEPISSSISNMELELNI
HNSKASKKNRLRRKSSTRHIHELELVVSRNLSPPNYTEVQIDSCSSSEELKKKNYNQMPV
RHSRKLQLMEDKERSTGAKKSSKSNEQSKRHASDTFPELRLTNIPDSFTNCSNTNELKEF
VNPSLPREEKEKLETVKLSNDAKDPNDLMLSGESVLQIERSVESSSISLVPGTDYGTQES
ISLLEVSTLGKAKTEPNKCVSQCAAFENPKELIHGGSKDTRNGTEGFKYPLGPEVNYSQE
TSIDMEESELDTQYLQNTFKVSKRQSFALFSNPGNPEKECATFSAHSGPLKKQSPKVTLE
CEQKEENQGEKESNSEPVETVNITAGFPMVCQKDKPVDYAKGIEGGSGLCLSSQFRGNET
GLIIPNKHGLLQNPYHIPPLIPTRSFVKTKYKKNLLEENSEEHSMSPERAMGNKNIIPST
VSTISHNNRENAFKETSSSSINEVGSSTNEVGSSINEVGSSDENIQAEIGRNRRPKLNAM
LRLELLQPEMYKQSLPISNCKHPDTKKQEHEVVQTVNTDLSPCLISDNVEQHMGSSHTCQ
VCSETPEDLLDDGEIKEDTSFAEYGIKETSAVFSKSVQRGELSRSPSPFTHTHLAQVYQR
GAKKLESSEENLSSEEEELPCFQHLLFGKVSNTPQSTRHNTVAIECLSKNTQENLLSLKS
SLNDCSNQVILAKASQEHHLSEETKCSGSLFSSQCSELEDLTTNTNTQDPFLIDSSKQKR
HQSESQGVGLSDKELDSDDEERGIDLEEDNQEEQSMDSNLGEAAFGYESETSITEDCSGL
SSQSDILTTQQRDTMQDNLIKLQQEMAELEAVLEQHGSQPSHSSPSVITVSSAPEDLQNP
EQSTSEKAVLTSQKSSEYPISQNPEGLSADKFEESSDSSTNKNKEPGVERSSPSKCQSLD
DRWCVHSCSGSLQNGNSPSQEELIKVDVEEQQLDKSGPHDLMEPSYLPRQDLEGTPYLES
GISLFSDDPESDPSEDRAPESSHAGSIPSSTSTLKVPQFQVAESAKSLAAAHTTNTAGCN
AMEENVSRQKPELAASTERVNKRKSMVVSGLTPEELVPMYKFARQHHITLTNQITEETTH
VVMKTDAEFVCERTLKYFLGIAGGKWVVSYFWVTQSIKERKMLNEHDFEVRGDVVNGRNH
QGPRRARESQGRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTLGTGIHA
VVVVQPDAWTEDNGLHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIPHSHY
NT seq 5574 nt NT seq  +upstreamnt  +downstreamnt
atggatttatctgctgttcatgttgaagaagtacaaaatgtccttaatgctatgcagaaa
atcttagagtgtccaatctgtctggagttgatcaaggaacctgtctccacaaagtgtgac
cacatattttgcaaattttgcatgctgaaacttcttaaccagaagaaagggccttcacag
tgtcctttgtgtaagaatgatataaccaaaagaagcctacaggaaagtacaagatttagt
caacttgttgaagaactattgaaaatcattcacgcttttgagcttgacacgggtttgcag
tttgcaaacagttataattttgccaaaaaggaaaataactctcctgaacatctaaaagat
gaattttctatcatccaaagtatgggctacagaaatcgtgccaaaagacttcgacagagt
gaaccccaaaatcctaccttgcaggaaaccaatctcagtgtccagctctctaaccctgga
attgtgagatctctgaggacaaagcagtggatacaacctcaaaataagtctgtctacatt
gacttgggatctgattcttctgaagatacaattaataagaaaacttactgcagtgtggga
gatcaagaattgttacaaatcacccctcaaggaaccagggatgaaaccagtttggattct
gcaaaaaaggctccttgtgagttttctgagaaggatataacaaatactgaacatcatcaa
tccagtagtaacaatttgaacaccactgagaagcatgcaactgagaggcatccagaaaag
tatcagagtagttctgtttcaaacttgcatgtggagccatgtggcacaaatactcatgcc
agctcattatggcatgagaacagcagtttattactcactaaagacagactgaatgtagaa
aaggctgaattctgtaataaaagcaaacagcctggcttagcaaggagccaacataacaga
tgggctgaaagtgaggaaacgtgtaatgataggcagactcccagcacagagaaaaaggta
gatctggatgctgatcccctgcatgggagaaaagaatggaatgagcagaaacctccatgc
tctgagaagcctagagatgatactgaagatgttgcttggttaacactaaatagcagcatt
cagaaagttaatgagtggttttccagaagtgatgaactgttaacttctgatgactcacat
gacgaggggtctgaatcaaatgccaaagtagctgaagcattggaagttctaaatgaagta
gatggatattctagttcttcagaaaaaatagacttactggccagtgatcctcatgatgct
ttaatatgtaaaagtgaaagagttcattgcaaatcagtagagagtagtattgaagataaa
atatttgggaaaacctatcggaggaaggcaagcctcccgaatttgagccatgtaactgaa
aatctaattataggagcatttgttactgaaccacagataacacaagagcatcctctcaca
aataaattaaagcgtaaaaggagagttacatcaggacttcatcctgaggattttatcaag
aaagcagatttggcagttcaaaagactcctgaaaagataaatcagggaactaaccaaatg
gagcggaatgatcaagtgatgaatattactaacagtggccatgagaataaaacaaaaggt
gattctattcagaatgagaacaatcctaacccagtagaatcactggaaaaagaatctttc
agaagtaaagctgaacctataagcagtagtataagcaatatggaactagaattaaatatc
cacaattccaaagcatctaaaaagaataggctgaggaggaagtcttctaccaggcatatt
catgagcttgaattagtagtcagtagaaatctaagcccacctaattatactgaagtacaa
attgatagttgttctagcagtgaagagctaaagaaaaaaaattacaaccaaatgccagtc
aggcacagcagaaagctacaactcatggaagataaagaacgttcaactggagccaaaaag
agtagcaagtcaaatgaacaaagtaaaagacatgccagtgatactttcccagaactgagg
ttaacaaacatacctgattcttttactaactgttcaaatactaatgaacttaaagaattt
gtcaatcctagccttccaagagaagaaaaagagaaactagaaacagttaaactgtctaat
gatgccaaagaccccaatgatctcatgttaagtggagaaagtgttttgcaaattgaaaga
tctgtagagagtagcagtatttcattggtacctggtactgattatggcactcaggaaagt
atctcattactggaagttagcactctagggaaggcaaaaacagaaccaaataaatgtgtg
agtcagtgtgcagcatttgaaaaccccaaggaactaattcatggtggttctaaagatact
agaaatggcacagaaggctttaagtatccattgggacctgaagttaactacagtcaggaa
acaagcatagatatggaagaaagtgaacttgatactcaatatttgcagaatacattcaag
gtttcaaagcgccagtcatttgctctgttttcaaatccaggaaatccagaaaaggaatgt
gcaacattctctgcccactctggacccttaaagaaacaaagtccaaaggtcactcttgaa
tgtgaacaaaaggaagaaaatcaaggagagaaagagtctaatagcgagcctgtagagaca
gttaacatcactgcaggctttcctatggtttgtcagaaagataagccagttgattatgcc
aaaggtattgaaggaggctctgggctttgtctatcatctcagttcagaggcaatgaaact
ggactcattattccaaataaacatggacttttacaaaacccatatcatataccaccactt
attcccaccaggtcattcgttaaaactaaatataagaaaaacctgctagaggaaaactct
gaagaacattcaatgtcacctgaaagagcaatgggaaacaagaacatcattccaagtaca
gtgagcacaattagccacaataacagagaaaatgcttttaaagaaaccagctcaagcagt
attaatgaagtaggttccagtactaatgaagtaggctccagtattaatgaagtaggttcc
agtgatgaaaacattcaagcagagataggtagaaacagaaggccaaaattgaatgctatg
cttagattagagcttttgcaacctgagatgtataagcaaagtcttcctataagtaattgt
aaacatcctgacactaaaaagcaagaacatgaagtagttcagactgttaatacagacctc
tctccatgtctgatttcagataacgtagaacagcatatgggaagcagtcatacatgtcag
gtttgttctgagacacctgaggacctgttagatgatggtgaaataaaggaagatactagt
tttgctgaatatggcattaaggaaacttctgctgtttttagcaaaagtgtccagagagga
gagctcagcaggagccctagccctttcacccatacgcatttggctcaggtttaccaaaga
ggggccaagaaattagagtcctcggaagagaacttatctagtgaggaagaagagcttccc
tgcttccaacacttgttatttggtaaagtaagcaatacacctcagtctaccaggcataac
actgttgctattgagtgcctgtctaagaacacacaggagaatttattatcattgaagagt
agcttaaatgactgcagtaaccaggtaatattggcaaaggcatcccaggaacatcacctt
agtgaggaaacaaaatgttctggtagcttgttttcttcacagtgcagtgaactggaagac
ttgactacaaatacaaacacccaggatcctttcttgattgattcttccaaacaaaagagg
catcagtctgaaagccagggagttggtctgagtgacaaggaattggattcagatgatgaa
gaaaggggaatagacttggaagaagataatcaagaagagcaaagtatggattcgaactta
ggtgaagcagcatttgggtatgagagtgaaacaagcatcactgaagactgctcagggcta
tcctctcagagtgatattttaaccactcagcagagggataccatgcaagacaatctgata
aagctccagcaggaaatggctgaactagaagctgtgttagaacagcatgggagccagcct
tctcacagctccccttccgtcataactgtctcttctgcccctgaggaccttcaaaatcca
gaacaaagcacatcagaaaaagcagtattaacttcacagaaaagtagtgaatatcctata
agccagaatccagaaggcctttctgctgacaagtttgaggagtcttcagatagttctacc
aataaaaataaagaaccaggagtggaaaggtcatccccttctaaatgccagtcattagat
gataggtggtgcgtgcacagttgctctgggagtcttcagaatggaaactccccatctcaa
gaggagctcattaaggttgatgtggaggagcaacaactggataagtctgggccccatgat
ttgatggaaccatcttacttgccaaggcaagatctagagggaaccccttacctagaatct
ggaatcagcctcttctctgatgaccctgaatctgatccttctgaagacagagccccagaa
tcatcccatgctggcagcataccatcttcaacctctacattgaaagtaccccagtttcaa
gttgcagaatctgccaagagtctagctgctgctcatactactaatactgctgggtgtaat
gcaatggaagaaaatgtgagcaggcagaagccagaactggcagcttcaacagaaagggtc
aataaaagaaagtccatggtggtgtcaggcttgaccccagaagaattagtgcccatgtac
aagtttgccagacaacaccacatcactttgactaatcaaattactgaagagactactcat
gttgttatgaaaacagatgctgagtttgtgtgtgaacggacactgaaatactttctggga
attgcaggaggaaaatgggtagttagctatttctgggtgacccagtctattaaagaaaga
aaaatgctgaatgagcatgattttgaagtcagaggagatgtggtcaatggaagaaaccac
caaggtccaagacgagcaagagaatcccagggcagaaagatcttcaggggcctggaaata
tgttgctatgggccgtttaccaatatgcccacagatcaactggagtggatggtgcagctg
tgtggggcttctgtggtgaaggagctttcatcattcacccttggcacaggtatccacgca
gttgtggttgtgcagccagatgcctggacagaggacaacggcttacatgcaattgggcag
atgtgtgaggcgcctgtggtgactcgagagtgggtgttggacagtgtagcactctaccag
tgccaggagctggacacctacctgataccccagatcccccacagccactactga

DBGET integrated database retrieval system