KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100388189Help
Entry
100388189         CDS       T03264                                 

Gene name
IL2RG
Definition
(RefSeq) interleukin 2 receptor subunit gamma
  KO
K05070  interleukin 2 receptor gamma
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04144  Endocytosis
cjc04151  PI3K-Akt signaling pathway
cjc04630  Jak-STAT signaling pathway
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc05162  Measles
cjc05166  Human T-cell leukemia virus 1 infection
cjc05200  Pathways in cancer
cjc05321  Inflammatory bowel disease (IBD)
cjc05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    100388189 (IL2RG)
   04151 PI3K-Akt signaling pathway
    100388189 (IL2RG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100388189 (IL2RG)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100388189 (IL2RG)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100388189 (IL2RG)
   04659 Th17 cell differentiation
    100388189 (IL2RG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100388189 (IL2RG)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    100388189 (IL2RG)
   05340 Primary immunodeficiency
    100388189 (IL2RG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100388189 (IL2RG)
   05162 Measles
    100388189 (IL2RG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:cjc04050]
    100388189 (IL2RG)
   04090 CD molecules [BR:cjc04090]
    100388189 (IL2RG)
Cytokine receptors [BR:cjc04050]
 Interleukin receptor families
  IL2 receptor family
   100388189 (IL2RG)
CD molecules [BR:cjc04090]
 Proteins
  100388189 (IL2RG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL6Ra-bind fn3 EpoR_lig-bind IL4Ra_N
Motif
Other DBs
NCBI-GeneID: 100388189
NCBI-ProteinID: NP_001288775
Ensembl: ENSCJAG00000013631
UniProt: A5HJL6
Position
X
AA seq 368 aa AA seqDB search
MLKALLPFRSLLFLQLPLLGVGLNTILTPNGNEDTTADFFLTSMPTDSFSVSTLPLPEVQ
CFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFAEEITSGCQLQKKE
IHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLRKLSESQLELNWNNRFLNH
CLEHLVQYRTDWDHTWTEQSVGHSHSFSLPSVDGQKHYTFRVRSRFNPLCGSTQHWSEWS
HLIHWGSNTSKENPFLFALEAVVISVGSMGLIISLLCVYFWLERTMPRIPTLKNLEDLVT
EYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGVLGEGAGASPCNQHSPYWAPP
SYTPKPET
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaggcattattaccattcagatctctcttattcctgcagctgcccctgctaggg
gtggggctgaacacaattctgacacccaatgggaatgaagacaccacagctgatttcttc
ctgacctctatgcccactgactccttcagtgtttccactctgcccctcccagaggttcag
tgttttgtgttcaatgtcgagtacatgaattgcacttggaacagcagctctgagccccag
cctaccaaccttactctgcactattggtacaagaactcagataatgataaagtccagaag
tgcagccactatctatttgctgaagaaatcacttctggctgtcagttgcaaaaaaaggag
atccacctctaccaaacatttgttgttcagctccaggacccacgggaacccaggagacag
gccacacagatgctaaaactgcagaatctggtgatcccctgggctccagagaacctaaca
cttcgcaaattgagtgaatcccagctagaactgaactggaacaacagattcttgaaccac
tgtttggagcacttggtgcagtaccggactgactgggaccacacctggactgaacaatca
gtaggccacagtcatagcttctccctgcctagtgtggatgggcagaaacactacacgttt
cgtgttcggagccgctttaacccactctgtggaagtactcagcattggagtgaatggagc
cacctgatccactggggtagcaacacttcaaaggagaatcctttcctgtttgcgttggaa
gctgtggttatctctgttggctccatgggattgattatcagccttctctgtgtgtatttc
tggctggaacggacaatgccccgaattcccaccctgaagaacctagaagatcttgttact
gaataccacgggaacttttcggcctggagtggtgtgtctaagggactggctgagagtctg
cagccagactacagtgaacgactctgcctcgtcagtgagattcccccaaaaggaggggtg
ctcggggagggagctggggcctccccatgcaaccagcatagcccctactgggccccacca
agttacaccccaaagcctgaaacctga

DBGET integrated database retrieval system