KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100388293Help
Entry
100388293         CDS       T03264                                 

Gene name
CCNA2, cyclin-A2
Definition
(RefSeq) cyclin A2
  KO
K06627  cyclin-A
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04110  Cell cycle
cjc04152  AMPK signaling pathway
cjc04218  Cellular senescence
cjc04914  Progesterone-mediated oocyte maturation
cjc05161  Hepatitis B
cjc05165  Human papillomavirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05200  Pathways in cancer
cjc05202  Transcriptional misregulation in cancer
cjc05203  Viral carcinogenesis
cjc05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    100388293 (CCNA2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100388293 (CCNA2)
   04218 Cellular senescence
    100388293 (CCNA2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100388293 (CCNA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100388293 (CCNA2)
   05202 Transcriptional misregulation in cancer
    100388293 (CCNA2)
   05203 Viral carcinogenesis
    100388293 (CCNA2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100388293 (CCNA2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100388293 (CCNA2)
   05161 Hepatitis B
    100388293 (CCNA2)
   05169 Epstein-Barr virus infection
    100388293 (CCNA2)
   05165 Human papillomavirus infection
    100388293 (CCNA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cjc03032]
    100388293 (CCNA2)
   03036 Chromosome and associated proteins [BR:cjc03036]
    100388293 (CCNA2)
DNA replication proteins [BR:cjc03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    100388293 (CCNA2)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    100388293 (CCNA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N Cyclin_N2 Cyclin_C Sororin
Motif
Other DBs
NCBI-GeneID: 100388293
NCBI-ProteinID: XP_002745481
Ensembl: ENSCJAG00000003023
UniProt: F7ILU7
Position
3
AA seq 432 aa AA seqDB search
MLGNSAPEPAAREAGSALLALQQTALQEDQENINPEKAAPIQPPRTRAALAVLKAGNPRG
ASQQQRPKTRRVAPLKDLPVNDEHVTVPSWKANSKQPAFTIHVDEAEEETHKKPAESQKA
EREDVMAFNSAVSLPGPRKPLVPLDYPMDGSFESPHTMDMSIVLEDEKPVSVNEVPDYHE
DIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYID
RFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLK
VLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAF
HLALYTVTGQSWPESLVQKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKHSKYHG
VSLLNPPETLNL
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgttgggcaactccgcgccggagcctgcagcccgcgaggcgggctcggcgctgctagca
ttgcagcagacggcgctccaagaggaccaggagaacatcaacccggaaaaggcagcgcct
atccagccaccgcggacccgggccgcgctggcggtactgaaggccgggaacccccggggt
gcatcgcagcagcagaggccgaagacgcgacgggttgcaccccttaaggatcttcctgta
aatgatgagcatgtcaccgttccttcttggaaagcaaacagtaaacagcctgcattcacc
attcatgtggatgaagcagaagaggagactcataagaagccagctgaatcccagaaggca
gagcgtgaagatgtcatggcttttaattcagcggttagtttacctggacccagaaaacca
ttggtacctcttgattatccaatggatggtagttttgagtcaccacatactatggacatg
tcaattgtattagaagatgaaaagccagtgagtgttaatgaagtaccagactaccatgag
gatattcacacgtaccttagggaaatggaggttaaatgtaaacctaaggtgggttacatg
aagaaacagccagacatcactaacagtatgagagctatcctcgtggactggttagttgaa
gtaggagaagaatataaactacagaatgagaccctgcatttggctgtgaactacattgat
aggttcctttcttccatgtccgtgctgagaggaaagcttcagcttgtgggcactgctgct
atgctgttagcctcaaagtttgaagaaatataccccccagaagtagcagagtttgtgtac
attacagatgatacctacaccaagaaacaagttctgagaatggagcatctagttttgaaa
gtccttacttttgacttagctgctccaacagtaaatcagtttcttacccaatactttctg
catcagcagcctgcaaactgcaaagttgaaagtttagcaatgtttttgggagaattaagt
ttgatagatgctgacccatacctgaagtatttgccatcggttattgctggagccgccttt
catttagcactctatacagtcacgggacaaagctggcctgaatcattagtccagaagact
ggatataccctggaaagtcttaagccttgtctcatggaccttcatcagacctacctcaaa
gcaccacagcatgcacaacagtcaataagagaaaagtacaaacattcaaagtatcatggt
gtttctctcctcaacccaccagagacactaaatctgtaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100393051Help
Entry
100393051         CDS       T03264                                 

Gene name
CCNA1
Definition
(RefSeq) cyclin A1
  KO
K06627  cyclin-A
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04110  Cell cycle
cjc04152  AMPK signaling pathway
cjc04218  Cellular senescence
cjc04914  Progesterone-mediated oocyte maturation
cjc05161  Hepatitis B
cjc05165  Human papillomavirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05200  Pathways in cancer
cjc05202  Transcriptional misregulation in cancer
cjc05203  Viral carcinogenesis
cjc05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    100393051 (CCNA1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100393051 (CCNA1)
   04218 Cellular senescence
    100393051 (CCNA1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100393051 (CCNA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100393051 (CCNA1)
   05202 Transcriptional misregulation in cancer
    100393051 (CCNA1)
   05203 Viral carcinogenesis
    100393051 (CCNA1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100393051 (CCNA1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100393051 (CCNA1)
   05161 Hepatitis B
    100393051 (CCNA1)
   05169 Epstein-Barr virus infection
    100393051 (CCNA1)
   05165 Human papillomavirus infection
    100393051 (CCNA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cjc03032]
    100393051 (CCNA1)
   03036 Chromosome and associated proteins [BR:cjc03036]
    100393051 (CCNA1)
DNA replication proteins [BR:cjc03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    100393051 (CCNA1)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    100393051 (CCNA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N Cyclin_C Cyclin_N2
Motif
Other DBs
NCBI-GeneID: 100393051
NCBI-ProteinID: XP_008996382
Ensembl: ENSCJAG00000018144
UniProt: F6SIC8
Position
5
AA seq 421 aa AA seqDB search
MHCSNPKSGVVLATVAGGPDVCQILTRAQVGQDAPQRTVLGLLTENGQYRRTCGQGITTI
RCFSGSENAFPPAGKKALPDCRVQEPHKQGFDIFMDELEQGNGDSCSGREGTAFEDVYEL
DTSTLKSDLHFLLDFDTVSPMLVESSLHSQPEDISDLDTHVINVTEYAEEIHQYLREAEI
RHRPKAHYMRKQPDITEGMRTILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMSVLRG
KLQLVGTAAILLASKYEEIYPPEVDEFVYITDDTYTKRQLLRMEHLLLKVLAFHLTVPTT
NQFLLQYLRRQGVCIRTENLAKYVAELSLLEADPFLKYLPSLTAAAAFCLANYTVNKHFW
PETLAAFTGYSFSEIAPCLNELHKAFLGTPHRPQQAVREKYKASKYLHVSLMEPPAVLPL
Q
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgcactgcagcaaccccaagagtggagttgtgctggctactgtggccggaggtcccgat
gtttgtcagatactcaccagggcccaggtgggccaggatgccccgcaaaggacagtgcta
gggctgctgactgaaaatgggcagtacaggaggacctgtggccaggggatcacaacaatc
aggtgtttttctggatcggaaaatgccttccctccagctggaaagaaagcgctccctgat
tgcagggtccaagagccccacaagcaagggtttgacatcttcatggacgaactagagcag
ggcaatggagacagctgctcaggcagagaggggacggcatttgaggatgtgtatgaatta
gataccagcacactcaagtcagacctgcacttcctgctggattttgacacagtgtccccg
atgctggtcgagtcgtcgctccactcccagcctgaagatatatctgatcttgacacacac
gtgataaatgtgactgaatatgctgaagaaattcatcagtaccttagagaagctgaaata
aggcacagacccaaagcacactacatgaggaagcaaccggacatcacagagggcatgcgc
acaattctggtggactggctggtggaggttggggaagaatataagcttcgagcagagact
ctgtacctggctgtcaacttcctggacagattcctttcgtgtatgtctgttctgagaggg
aaattgcagctcgtaggaacagcagctattcttttggcttcgaaatatgaagagatctat
cctcccgaagtagacgagttcgtctatataactgatgatacatacacaaaacgacaactg
ttaagaatggaacacttgcttctgaaagttctggcttttcatctgacagtaccaaccacc
aaccagtttctccttcagtacttgaggcgacaaggagtgtgcatcaggacagagaacctg
gctaagtatgtagcagagctgagtctacttgaagcggacccattcttgaagtatcttccc
tcattgacggctgcagccgctttctgcctggccaactatactgtgaacaagcacttttgg
ccagaaacccttgctgcatttactgggtattcattcagtgaaattgcgccctgtctgaat
gagcttcataaggcattccttggcacaccccatcgacctcagcaagcagttagggagaag
tacaaggcctcaaagtacctgcatgtgtctctcatggaaccacctgcagttcttcctcta
cagtaa

DBGET integrated database retrieval system