KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100388391Help
Entry
100388391         CDS       T03264                                 

Gene name
IFNB1
Definition
(RefSeq) interferon beta 1
  KO
K05415  interferon beta
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04151  PI3K-Akt signaling pathway
cjc04217  Necroptosis
cjc04380  Osteoclast differentiation
cjc04620  Toll-like receptor signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04622  RIG-I-like receptor signaling pathway
cjc04623  Cytosolic DNA-sensing pathway
cjc04630  Jak-STAT signaling pathway
cjc04650  Natural killer cell mediated cytotoxicity
cjc04668  TNF signaling pathway
cjc05142  Chagas disease (American trypanosomiasis)
cjc05152  Tuberculosis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05165  Human papillomavirus infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    100388391 (IFNB1)
   04668 TNF signaling pathway
    100388391 (IFNB1)
   04151 PI3K-Akt signaling pathway
    100388391 (IFNB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100388391 (IFNB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100388391 (IFNB1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100388391 (IFNB1)
   04621 NOD-like receptor signaling pathway
    100388391 (IFNB1)
   04622 RIG-I-like receptor signaling pathway
    100388391 (IFNB1)
   04623 Cytosolic DNA-sensing pathway
    100388391 (IFNB1)
   04650 Natural killer cell mediated cytotoxicity
    100388391 (IFNB1)
  09158 Development
   04380 Osteoclast differentiation
    100388391 (IFNB1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100388391 (IFNB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100388391 (IFNB1)
   05162 Measles
    100388391 (IFNB1)
   05164 Influenza A
    100388391 (IFNB1)
   05161 Hepatitis B
    100388391 (IFNB1)
   05160 Hepatitis C
    100388391 (IFNB1)
   05168 Herpes simplex virus 1 infection
    100388391 (IFNB1)
   05163 Human cytomegalovirus infection
    100388391 (IFNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100388391 (IFNB1)
   05169 Epstein-Barr virus infection
    100388391 (IFNB1)
   05165 Human papillomavirus infection
    100388391 (IFNB1)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    100388391 (IFNB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100388391 (IFNB1)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interferons
   100388391 (IFNB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Interferon
Motif
Other DBs
NCBI-GeneID: 100388391
NCBI-ProteinID: XP_017825037
Ensembl: ENSCJAG00000008865
Position
1
AA seq 213 aa AA seqDB search
MEKGHSNCNLWKTALAQEVVGDTVSVFIMTRKCLLQIALLLCFSTTAISMSGNLLGFLQR
RSNFQSQKLLWQLNGRLEYCLKDRMNFEVPKEITQPQQLQKEDAALIIYEMLENIFTIFR
GDFSRTGWNETIVENLLANVYQHAEHLNTILKEKWEEKEFTRGKFMSTLYLKRYYGRILH
YLKAKEYSHCAWTIVRVEMLRNFYFINRLTSYL
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaggacattctaactgcaacctttggaagactgctctggcacaagaggtagta
ggcgacactgtttctgttttcatcatgacccgcaagtgtctcctccaaattgctctcctg
ttgtgcttctccactacagctatttccatgagtggcaacttgcttggattcctacaaaga
agaagcaattttcagagtcagaagctcctgtggcaattgaatggaaggcttgaatattgc
ctcaaggacaggatgaactttgaggtccctaaggagatcacacaaccgcagcaactccag
aaggaggacgccgcattaatcatctatgagatgctcgagaacatctttactattttcaga
ggagacttctctaggactggctggaatgagactattgttgagaacctccttgctaatgtc
tatcagcatgcagaacatctgaacacaatcctgaaagaaaaatgggaagaaaaagaattc
accaggggaaaattcatgagcactctgtacctgaaaagatattatgggaggattctgcat
tacctgaaggccaaggagtacagccactgtgcctggaccatagtcagagtggaaatgctc
aggaacttttactttattaacagacttacaagttacctctga

DBGET integrated database retrieval system