KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100388410Help
Entry
100388410         CDS       T03264                                 

Gene name
CAMK4
Definition
(RefSeq) calcium/calmodulin dependent protein kinase IV
  KO
K05869  calcium/calmodulin-dependent protein kinase IV [EC:2.7.11.17]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04020  Calcium signaling pathway
cjc04024  cAMP signaling pathway
cjc04211  Longevity regulating pathway
cjc04371  Apelin signaling pathway
cjc04380  Osteoclast differentiation
cjc04720  Long-term potentiation
cjc04722  Neurotrophin signaling pathway
cjc04725  Cholinergic synapse
cjc04921  Oxytocin signaling pathway
cjc04925  Aldosterone synthesis and secretion
cjc05031  Amphetamine addiction
cjc05034  Alcoholism
cjc05214  Glioma
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100388410 (CAMK4)
   04020 Calcium signaling pathway
    100388410 (CAMK4)
   04024 cAMP signaling pathway
    100388410 (CAMK4)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100388410 (CAMK4)
   04925 Aldosterone synthesis and secretion
    100388410 (CAMK4)
  09156 Nervous system
   04725 Cholinergic synapse
    100388410 (CAMK4)
   04720 Long-term potentiation
    100388410 (CAMK4)
   04722 Neurotrophin signaling pathway
    100388410 (CAMK4)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100388410 (CAMK4)
  09149 Aging
   04211 Longevity regulating pathway
    100388410 (CAMK4)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    100388410 (CAMK4)
  09165 Substance dependence
   05031 Amphetamine addiction
    100388410 (CAMK4)
   05034 Alcoholism
    100388410 (CAMK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100388410 (CAMK4)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     100388410 (CAMK4)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   100388410 (CAMK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like FTA2 Kdo Pkinase_fungal APH YrbL-PhoP_reg
Motif
Other DBs
NCBI-GeneID: 100388410
NCBI-ProteinID: XP_008989960
Ensembl: ENSCJAG00000016346
UniProt: F7I122
Position
2
AA seq 473 aa AA seqDB search
MLKVTVPSCSSSSCSSVTASAAPGTASLVPDYWIDGSNRDALSDFFEVESELGRGATSIV
YRCKQKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLEL
VTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAP
LKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEP
FYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVRKLIVLDPKKRLTTFQALQHPWV
TGKAANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSSHGSIQESHKPSRDPS
PIQDSNEDIKAIPEGEKIQGDGARAPIKGAQAELMKLQALEKVKDADINAEEVPRMVPKA
VKDGIKMADPETEEGLAEEKLKTVEEAAAPREGQGSSAVGFEVPQQDVILPEY
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaagtcacggtgccctcctgttcctcctcgtcctgctcttcggtcaccgccagt
gcggcccccgggaccgcgagcctcgtcccggattactggatcgacggctccaacagggat
gcgctgagcgatttcttcgaggtggagtcggagctgggacggggtgctacatccattgtg
tacagatgcaaacagaaggggacccaaaagccttatgctctcaaagtgttaaaaaaaaca
gtggacaaaaaaatcgtaagaactgagataggagttcttcttcgtctctcacatccaaac
attataaaacttaaagagatatttgaaacccctacagaaatcagtctggtcctagaactc
gtcacaggaggagaactgtttgataggattgtggaaaagggatattacagtgagcgagat
gctgcagatgctgttaaacaaatcctggaggcagtcgcttatctacatgaaaatggaatt
gtccatcgtgatctcaaaccagagaatcttctctatgcaactccagccccagatgctcca
ctcaaaattgctgattttggactctctaaaattgtggaacatcaagtgctcatgaagaca
gtatgtggaaccccagggtactgcgcacctgaaattctaagaggttgtgcctatggacct
gaggtggacatgtggtctgtaggaataatcacctacatcttactttgtggatttgaacca
ttctatgatgaacgaggcgatcagttcatgttcaggagaattctgaattgtgaatattac
ttcatctccccctggtgggatgaagtatctctaaatgccaaggatttggtcagaaaatta
atagttttggatccaaagaaacggctgactacctttcaagctctccagcatccatgggtc
acaggtaaagcagccaattttgtacacatggatactgctcaaaagaagctccaagaattc
aatgctcggcgtaagcttaaggcagcggtgaaggctgtagtggcctcttcccggctggga
agtgccagcagcagccatggcagcatccaggagagccacaagcctagccgagatccttct
ccaattcaagacagcaacgaggacatcaaagctattccagaaggagagaaaattcaagga
gatggggctcgagccccaattaagggggcacaggctgagctgatgaagttgcaggcttta
gagaaagttaaagatgcagatataaatgctgaagaggtccccaggatggtgcccaaggca
gtgaaggatgggataaagatggccgaccctgaaacagaggagggcctggcagaggagaag
ctgaagactgtggaggaagcagcagcccccagagaagggcaaggaagctctgctgtggga
tttgaagttccacagcaagatgtgatcctgccagagtactaa

DBGET integrated database retrieval system