KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100388493Help
Entry
100388493         CDS       T03264                                 

Gene name
RELA
Definition
(RefSeq) RELA proto-oncogene, NF-kB subunit
  KO
K04735  transcription factor p65
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01523  Antifolate resistance
cjc04010  MAPK signaling pathway
cjc04014  Ras signaling pathway
cjc04024  cAMP signaling pathway
cjc04062  Chemokine signaling pathway
cjc04064  NF-kappa B signaling pathway
cjc04066  HIF-1 signaling pathway
cjc04071  Sphingolipid signaling pathway
cjc04137  Mitophagy - animal
cjc04151  PI3K-Akt signaling pathway
cjc04210  Apoptosis
cjc04211  Longevity regulating pathway
cjc04218  Cellular senescence
cjc04380  Osteoclast differentiation
cjc04620  Toll-like receptor signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04622  RIG-I-like receptor signaling pathway
cjc04623  Cytosolic DNA-sensing pathway
cjc04625  C-type lectin receptor signaling pathway
cjc04657  IL-17 signaling pathway
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04660  T cell receptor signaling pathway
cjc04662  B cell receptor signaling pathway
cjc04668  TNF signaling pathway
cjc04722  Neurotrophin signaling pathway
cjc04917  Prolactin signaling pathway
cjc04920  Adipocytokine signaling pathway
cjc04926  Relaxin signaling pathway
cjc04931  Insulin resistance
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc05030  Cocaine addiction
cjc05132  Salmonella infection
cjc05133  Pertussis
cjc05134  Legionellosis
cjc05140  Leishmaniasis
cjc05142  Chagas disease (American trypanosomiasis)
cjc05145  Toxoplasmosis
cjc05146  Amoebiasis
cjc05152  Tuberculosis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05165  Human papillomavirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05202  Transcriptional misregulation in cancer
cjc05203  Viral carcinogenesis
cjc05212  Pancreatic cancer
cjc05215  Prostate cancer
cjc05220  Chronic myeloid leukemia
cjc05221  Acute myeloid leukemia
cjc05222  Small cell lung cancer
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cjc05321  Inflammatory bowel disease (IBD)
cjc05418  Fluid shear stress and atherosclerosis
Module
cjc_M00686  Toll-like receptor signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100388493 (RELA)
   04010 MAPK signaling pathway
    100388493 (RELA)
   04064 NF-kappa B signaling pathway
    100388493 (RELA)
   04668 TNF signaling pathway
    100388493 (RELA)
   04066 HIF-1 signaling pathway
    100388493 (RELA)
   04071 Sphingolipid signaling pathway
    100388493 (RELA)
   04024 cAMP signaling pathway
    100388493 (RELA)
   04151 PI3K-Akt signaling pathway
    100388493 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100388493 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    100388493 (RELA)
   04218 Cellular senescence
    100388493 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100388493 (RELA)
   04621 NOD-like receptor signaling pathway
    100388493 (RELA)
   04622 RIG-I-like receptor signaling pathway
    100388493 (RELA)
   04623 Cytosolic DNA-sensing pathway
    100388493 (RELA)
   04625 C-type lectin receptor signaling pathway
    100388493 (RELA)
   04660 T cell receptor signaling pathway
    100388493 (RELA)
   04658 Th1 and Th2 cell differentiation
    100388493 (RELA)
   04659 Th17 cell differentiation
    100388493 (RELA)
   04657 IL-17 signaling pathway
    100388493 (RELA)
   04662 B cell receptor signaling pathway
    100388493 (RELA)
   04062 Chemokine signaling pathway
    100388493 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100388493 (RELA)
   04917 Prolactin signaling pathway
    100388493 (RELA)
   04926 Relaxin signaling pathway
    100388493 (RELA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100388493 (RELA)
  09158 Development
   04380 Osteoclast differentiation
    100388493 (RELA)
  09149 Aging
   04211 Longevity regulating pathway
    100388493 (RELA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100388493 (RELA)
   05202 Transcriptional misregulation in cancer
    100388493 (RELA)
   05203 Viral carcinogenesis
    100388493 (RELA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100388493 (RELA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100388493 (RELA)
   05221 Acute myeloid leukemia
    100388493 (RELA)
   05220 Chronic myeloid leukemia
    100388493 (RELA)
   05215 Prostate cancer
    100388493 (RELA)
   05222 Small cell lung cancer
    100388493 (RELA)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    100388493 (RELA)
  09165 Substance dependence
   05030 Cocaine addiction
    100388493 (RELA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100388493 (RELA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100388493 (RELA)
   04931 Insulin resistance
    100388493 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100388493 (RELA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100388493 (RELA)
   05133 Pertussis
    100388493 (RELA)
   05134 Legionellosis
    100388493 (RELA)
   05152 Tuberculosis
    100388493 (RELA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100388493 (RELA)
   05170 Human immunodeficiency virus 1 infection
    100388493 (RELA)
   05162 Measles
    100388493 (RELA)
   05164 Influenza A
    100388493 (RELA)
   05161 Hepatitis B
    100388493 (RELA)
   05160 Hepatitis C
    100388493 (RELA)
   05168 Herpes simplex virus 1 infection
    100388493 (RELA)
   05163 Human cytomegalovirus infection
    100388493 (RELA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100388493 (RELA)
   05169 Epstein-Barr virus infection
    100388493 (RELA)
   05165 Human papillomavirus infection
    100388493 (RELA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100388493 (RELA)
   05145 Toxoplasmosis
    100388493 (RELA)
   05140 Leishmaniasis
    100388493 (RELA)
   05142 Chagas disease (American trypanosomiasis)
    100388493 (RELA)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100388493 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100388493 (RELA)
Transcription factors [BR:cjc03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    100388493 (RELA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RHD_DNA_bind RHD_dimer
Motif
Other DBs
NCBI-GeneID: 100388493
NCBI-ProteinID: XP_017833773
Position
11
AA seq 495 aa AA seqDB search
MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAINQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLLPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVFMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFNGPTDPRPPPRRIAVPSRSSASIPKPAPQPYPFSPSLNTINY
DEFPTMVFPSEQISQASALALAPPQVLPQAPAPAPAPAPAPAPPMVPALAQAPAPGPVLA
PGPPHAMAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEF
QQLMKPELTCGPTHS
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggacgagttgttccccctcatcttcccggcagagccagcccaggcctctggcccctat
gtggagatcattgagcagcccaagcagcggggcatgcgcttccgctacaagtgcgaggga
cgctccgcgggcagcatccctggcgagaggagcacagataccaccaagacgcaccccacc
atcaagatcaatggctacacagggccagggacagtacgcatctccctggtcaccaaggac
cctcctcaccggcctcacccccatgagcttgtaggaaaagactgccgggatggcttctac
gaggctgagctctgcccggaccgctgcatccacagtttccagaacctgggaatccagtgt
gtgaagaagcgagatctggagcaggctatcaatcagcgcatccagaccaacaacaacccc
ttccaagttcccatagaagagcagcgtggggactatgacctgaacgctgtgcggctctgc
ttccaggtgacagtgcgggatccatcaggcaggcccctccgcctgctgcctgtcctctct
catcccatctttgacaaccgtgctcccaacactgccgagctcaagatctgccgagtgaac
cgaaactctggcagctgcctcggtggggatgagatcttcctgctgtgtgacaaggtgcag
aaagaggacattgaggtgtatttcacggggccaggctgggaggcccgaggctccttttca
caagctgatgtgcaccgccaagtggccattgtgttccggacccctccctatgcagacccc
agtctgcaggctcctgttcgtgtgttcatgcagctgcggcggccttccgaccgggagctc
agcgagcccatggaattccagtacctgccagatacagatgatcgccaccggattgaggag
aaacgcaaaaggacatatgagaccttcaagagtatcatgaagaagagtcctttcaatgga
cccactgacccccggcctccaccccggcgcattgctgtgccttcgcgcagttcagcttct
atccccaagccagcccctcagccctatcccttttcgccatccctgaacaccatcaactat
gatgagtttcccaccatggtgtttccttctgagcagataagccaggcctcagccttggcc
ctagcccctccccaagtcctgccgcaagctccagccccagcccctgcccctgcccctgcc
cctgccccacccatggtaccagctctggcccaggccccagcccctggcccagtcctagcc
ccaggccctcctcatgctatggccccacctgcccccaagcccacgcaggctggggaagga
acactatcagaggccctgctgcagctgcagtttgatgatgaagacctgggggccttgctt
ggcaacagcacagatccagctgtgttcacagacctggcatccgtcgacaactcggagttt
cagcagctgatgaaaccagagcttacctgtggccccacacacagctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100415321Help
Entry
100415321         CDS       T03264                                 

Gene name
NFKB1
Definition
(RefSeq) nuclear factor kappa B subunit 1
  KO
K02580  nuclear factor NF-kappa-B p105 subunit
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01523  Antifolate resistance
cjc04010  MAPK signaling pathway
cjc04014  Ras signaling pathway
cjc04024  cAMP signaling pathway
cjc04062  Chemokine signaling pathway
cjc04064  NF-kappa B signaling pathway
cjc04066  HIF-1 signaling pathway
cjc04071  Sphingolipid signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04210  Apoptosis
cjc04211  Longevity regulating pathway
cjc04218  Cellular senescence
cjc04380  Osteoclast differentiation
cjc04620  Toll-like receptor signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04622  RIG-I-like receptor signaling pathway
cjc04623  Cytosolic DNA-sensing pathway
cjc04625  C-type lectin receptor signaling pathway
cjc04657  IL-17 signaling pathway
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04660  T cell receptor signaling pathway
cjc04662  B cell receptor signaling pathway
cjc04668  TNF signaling pathway
cjc04722  Neurotrophin signaling pathway
cjc04917  Prolactin signaling pathway
cjc04920  Adipocytokine signaling pathway
cjc04926  Relaxin signaling pathway
cjc04931  Insulin resistance
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc05030  Cocaine addiction
cjc05132  Salmonella infection
cjc05133  Pertussis
cjc05134  Legionellosis
cjc05140  Leishmaniasis
cjc05142  Chagas disease (American trypanosomiasis)
cjc05145  Toxoplasmosis
cjc05146  Amoebiasis
cjc05152  Tuberculosis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05165  Human papillomavirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05202  Transcriptional misregulation in cancer
cjc05203  Viral carcinogenesis
cjc05206  MicroRNAs in cancer
cjc05212  Pancreatic cancer
cjc05215  Prostate cancer
cjc05220  Chronic myeloid leukemia
cjc05221  Acute myeloid leukemia
cjc05222  Small cell lung cancer
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cjc05321  Inflammatory bowel disease (IBD)
cjc05418  Fluid shear stress and atherosclerosis
Module
cjc_M00686  Toll-like receptor signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100415321 (NFKB1)
   04010 MAPK signaling pathway
    100415321 (NFKB1)
   04064 NF-kappa B signaling pathway
    100415321 (NFKB1)
   04668 TNF signaling pathway
    100415321 (NFKB1)
   04066 HIF-1 signaling pathway
    100415321 (NFKB1)
   04071 Sphingolipid signaling pathway
    100415321 (NFKB1)
   04024 cAMP signaling pathway
    100415321 (NFKB1)
   04151 PI3K-Akt signaling pathway
    100415321 (NFKB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100415321 (NFKB1)
   04218 Cellular senescence
    100415321 (NFKB1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100415321 (NFKB1)
   04621 NOD-like receptor signaling pathway
    100415321 (NFKB1)
   04622 RIG-I-like receptor signaling pathway
    100415321 (NFKB1)
   04623 Cytosolic DNA-sensing pathway
    100415321 (NFKB1)
   04625 C-type lectin receptor signaling pathway
    100415321 (NFKB1)
   04660 T cell receptor signaling pathway
    100415321 (NFKB1)
   04658 Th1 and Th2 cell differentiation
    100415321 (NFKB1)
   04659 Th17 cell differentiation
    100415321 (NFKB1)
   04657 IL-17 signaling pathway
    100415321 (NFKB1)
   04662 B cell receptor signaling pathway
    100415321 (NFKB1)
   04062 Chemokine signaling pathway
    100415321 (NFKB1)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100415321 (NFKB1)
   04917 Prolactin signaling pathway
    100415321 (NFKB1)
   04926 Relaxin signaling pathway
    100415321 (NFKB1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100415321 (NFKB1)
  09158 Development
   04380 Osteoclast differentiation
    100415321 (NFKB1)
  09149 Aging
   04211 Longevity regulating pathway
    100415321 (NFKB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100415321 (NFKB1)
   05202 Transcriptional misregulation in cancer
    100415321 (NFKB1)
   05206 MicroRNAs in cancer
    100415321 (NFKB1)
   05203 Viral carcinogenesis
    100415321 (NFKB1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100415321 (NFKB1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100415321 (NFKB1)
   05221 Acute myeloid leukemia
    100415321 (NFKB1)
   05220 Chronic myeloid leukemia
    100415321 (NFKB1)
   05215 Prostate cancer
    100415321 (NFKB1)
   05222 Small cell lung cancer
    100415321 (NFKB1)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    100415321 (NFKB1)
  09165 Substance dependence
   05030 Cocaine addiction
    100415321 (NFKB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100415321 (NFKB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100415321 (NFKB1)
   04931 Insulin resistance
    100415321 (NFKB1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100415321 (NFKB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100415321 (NFKB1)
   05133 Pertussis
    100415321 (NFKB1)
   05134 Legionellosis
    100415321 (NFKB1)
   05152 Tuberculosis
    100415321 (NFKB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100415321 (NFKB1)
   05170 Human immunodeficiency virus 1 infection
    100415321 (NFKB1)
   05162 Measles
    100415321 (NFKB1)
   05164 Influenza A
    100415321 (NFKB1)
   05161 Hepatitis B
    100415321 (NFKB1)
   05160 Hepatitis C
    100415321 (NFKB1)
   05168 Herpes simplex virus 1 infection
    100415321 (NFKB1)
   05163 Human cytomegalovirus infection
    100415321 (NFKB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100415321 (NFKB1)
   05169 Epstein-Barr virus infection
    100415321 (NFKB1)
   05165 Human papillomavirus infection
    100415321 (NFKB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100415321 (NFKB1)
   05145 Toxoplasmosis
    100415321 (NFKB1)
   05140 Leishmaniasis
    100415321 (NFKB1)
   05142 Chagas disease (American trypanosomiasis)
    100415321 (NFKB1)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100415321 (NFKB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100415321 (NFKB1)
Transcription factors [BR:cjc03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    100415321 (NFKB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RHD_DNA_bind RHD_dimer Ank_2 Ank_4 Ank Ank_3 Ank_5 Death
Motif
Other DBs
NCBI-GeneID: 100415321
NCBI-ProteinID: XP_002745591
Ensembl: ENSCJAG00000015382
UniProt: F6V7I0
Position
3
AA seq 969 aa AA seqDB search
MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTADGPYLQILEQPKQRGFRFRY
VCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNTHLHAHSLVGKHCE
DGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQ
AEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAI
YDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGD
FSPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEV
QRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGSGGGGTGSTGPGYSFPHYGFPTYGGISF
HPGTTKSNAGMKHGAMDSESKTDPEGCDKSDDRDTVNLCRKVTETTEQDQEPSKATDGNG
EVTLTYATGTKEENAEVQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAVQ
DENGDSVLHLAIIHLHSQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVE
DLLRAGADLSLLDRFGNSVLHLAAKEGNDKVLSILLKHKKAALLLDYPNGDGLNAIHLAM
MSNSLPCLLLLVAAGANVNAQEQKSGRTALHLAVEHDNISLAGCLLLEGDAHVDSTTYDG
TTPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWENAGEDEGVVSGTTPLDMA
TSWQVFDILNGKPYEPEFTSDDLLAQGDMKQLAEDVKLQLYKLLEIPDPDKNWATLAQKL
GLGILNNAFRLSPAPSKTLMDNYEVSGGTVRELVEALRQMGYTEAIEVIQAASSPVKTTS
QAHSLPLSPASTRQQIDELRDSDSVCDSGVETSFHKLSFTESLTSGGSLLTLNKMPHDYG
QEGPLEGKI
NT seq 2910 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagatgatccatatttgggaaggcctgaacaaatgtttcatttggatccttct
ttgactcatacaatatttaatccagaagtatttcaaccacagatggcactgccaacagca
gatggcccataccttcaaatattagagcaacctaaacagagaggatttcgtttccgttac
gtctgtgaaggcccatcccatggtggactacctggtgcctctagcgaaaagaacaagaag
tcttaccctcaggtcaaaatctgcaactatgtgggaccagcaaaggttattgttcagttg
gtcacaaatggaaaaaatacccacctgcatgctcacagcctggtgggaaaacactgtgag
gatgggatctgcactgtaactgctggacccaaggacatggtggtcggctttgcaaacttg
ggtatacttcatgtgacaaagaaaaaagtatttgaaacactggaagcgcgaatgacagag
gcatgtataaggggctacaatcctgggctcttggtgcaccctgaccttgcgtatttgcaa
gcagaaggtggaggggaccggcagctgggagatcgggaaaaagagctaatccgccaggca
gctctgcagcagaccaaggagatggacctcagcgtggtgcggctcatgtttacagctttt
cttccggatagcactggcagcttcacaaggcgcctggaacccgtggtatcagacgccatc
tatgacagtaaagcccccaatgcatccaacttaaaaattgtaagaatggacaggacagct
ggatgtgtgactggaggagaggaaatttatcttctctgtgacaaagttcagaaagatgac
atccagattcgattttatgaagaagaggaaaatggtggagtctgggaaggatttggagat
ttttcccccacagatgttcatagacaatttgccatcgtcttcaaaaccccaaagtataaa
gatgttaatattacaaaaccagcttctgtgtttgtccagcttcggaggaaatctgacttg
gaaactagtgaaccaaaacctttcctttactatcctgaaataaaagataaagaagaagtg
cagaggaaacgacaaaagctcatgcccaatttttcggatagtttcggcggtggtagtggt
gctggagctggaggtggaggcatgtttggtagtggcagtggaggagggggcactggaagt
acaggtccagggtatagcttcccacactatggatttcctacttatggagggatttccttc
catcctggaactactaaatctaatgctgggatgaaacatggagccatggacagtgaatct
aaaacggaccctgaaggttgtgacaaaagtgatgatagagacactgtaaacctctgtaga
aaagtcactgaaaccacagagcaggatcaggagcccagcaaggccactgatgggaatggt
gaggtcactctaacgtatgcaacaggaaccaaagaagagaatgctgaggttcaggataac
ctctttctagagaaggctatgcagcttgcgaagaggcatgccaatgcccttttcgactat
gcagtgacaggagatgtgaagatgttgctggctgtccagcgccatctcactgctgtgcag
gatgagaatggggacagtgtcttacacctagcaatcatccaccttcattctcaacttgtg
agggatctactggaagtcacgtctggtttgatttctgatgacattatcaacatgagaaat
gacctgtaccagacacccttgcacttggcagtgatcactaagcaggaagatgtggtggag
gatttgctgagggccggggccgacctgagccttctggaccgcttcggtaactctgttttg
cacctagctgccaaagaaggaaatgataaagttctcagtatcttactcaagcacaaaaag
gcagcactacttcttgactaccccaacggggacggtctgaatgccattcatctagccatg
atgagcaatagcctgccatgtctgctgctgctggtggccgctggggccaacgtcaatgct
caggagcaaaagtccggacgcacagcactgcacctagctgtggagcacgacaacatctca
ttggctggctgcctgctccttgagggtgatgcccatgtggacagtactacctacgatgga
actacacccctgcatatagcagctgggagagggtccaccaggctggccgctcttctcaaa
gcggcaggagcagatcccctggtggagaactttgagcctctctatgacctggatgactct
tgggaaaatgcaggagaggatgaaggagttgtatctggaaccacacctctagatatggcc
accagctggcaggtatttgacatattaaatgggaaaccatatgagccagagtttacatct
gatgatttactagcacaaggagacatgaaacagctggctgaagatgtgaagctgcagctc
tataagttgctagaaattcctgatccagacaaaaactgggctaccctggcacagaaatta
ggtctggggatacttaataatgccttccggctgagtcctgctccttccaaaacacttatg
gacaactatgaggtctctggggggacggtcagagagctggtggaggccctgagacaaatg
ggctacactgaagcaattgaagtgatccaggcggcctccagcccagtgaagaccacctcg
caggcccactcgctgcctctctcgcctgcatccacaaggcagcaaatagatgagctccga
gacagcgacagtgtctgcgacagcggcgtggagacgtccttccacaagctcagctttacc
gagtctctgaccagtggtggctcactgctaactctcaacaaaatgccccatgattatggg
caggaaggacctctagaaggcaaaatttag

DBGET integrated database retrieval system