KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100388552Help
Entry
100388552         CDS       T03264                                 

Gene name
STAT5B
Definition
(RefSeq) signal transducer and activator of transcription 5B
  KO
K11224  signal transducer and activator of transcription 5B
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04012  ErbB signaling pathway
cjc04062  Chemokine signaling pathway
cjc04217  Necroptosis
cjc04630  Jak-STAT signaling pathway
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04917  Prolactin signaling pathway
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc05161  Hepatitis B
cjc05162  Measles
cjc05166  Human T-cell leukemia virus 1 infection
cjc05200  Pathways in cancer
cjc05203  Viral carcinogenesis
cjc05220  Chronic myeloid leukemia
cjc05221  Acute myeloid leukemia
cjc05223  Non-small cell lung cancer
Module
cjc_M00684  JAK-STAT signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100388552 (STAT5B)
   04630 Jak-STAT signaling pathway
    100388552 (STAT5B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100388552 (STAT5B)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100388552 (STAT5B)
   04659 Th17 cell differentiation
    100388552 (STAT5B)
   04062 Chemokine signaling pathway
    100388552 (STAT5B)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100388552 (STAT5B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100388552 (STAT5B)
   05203 Viral carcinogenesis
    100388552 (STAT5B)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100388552 (STAT5B)
   05220 Chronic myeloid leukemia
    100388552 (STAT5B)
   05223 Non-small cell lung cancer
    100388552 (STAT5B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100388552 (STAT5B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100388552 (STAT5B)
   05162 Measles
    100388552 (STAT5B)
   05161 Hepatitis B
    100388552 (STAT5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100388552 (STAT5B)
Transcription factors [BR:cjc03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   STAT
    100388552 (STAT5B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2
Motif
Other DBs
NCBI-GeneID: 100388552
NCBI-ProteinID: XP_008995854
Position
5
AA seq 788 aa AA seqDB search
MAVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSIDLDNPQENIKATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNGSSPAGNLADTMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFATLGQLSPQERLSRETALQQNQVSLEAWLQREAQTLQQYRLELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRSDRRGAESVTEEKFTILFESQFSIGGNELVFQVKTLSLPVVVIVHGSQDNNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNN
SSSHLEDYSGLSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADRL
GDLNYLIYVFPDRPKDEVYSKYYTPVPCESATAKAVDGYVKPQIKQVVPEFVNISADAGG
GSSATYMDQAPSPAVCPQAHYNMYPQNPDSVLDTDGDFDLEDTMDVARRVEELLGRPMDS
QWIPHAQS
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgtggatacaagctcagcagctccaaggagaagcccttcatcagatgcaagcg
ttgtatggccagcattttcccattgaggtgcggcattatttatcccagtggattgaaagc
caagcatgggactcaatagatcttgataatccacaggagaacattaaggccacccagctc
ctggagggcctggtgcaggagctgcaaaagaaggcggagcaccaggtgggggaagatggg
tttttactgaagatcaagctggggcactacgccacgcagctccagaacacatatgaccgc
tgccccatggagctggtccgctgcatccgccatatattgtacaatgaacagaggttggtc
cgagaagccaacaatggtagttctccagctggaaaccttgctgacaccatgtcccagaaa
cacctgcagatcaaccagacatttgaggagctgcgactggtcacgcaggacacagagaat
gagctgaagaagctgcagcagactcaggagtacttcatcatccagtaccaggaaagcctg
aggatccaagctcagtttgccacgctgggccagctgagcccccaggagcgtctgagccgg
gagacggcgctccagcaaaaccaggtgtccctggaggcctggctgcagcgcgaggcacag
acgctacagcagtaccgcctggagctggccgagaagcaccagaagaccctgcagctgctg
cggaagcaacagaccatcatcctggatgacgagctgatccagtggaagcggcggcagcag
ctggccgggaacggcgggccccccgagggcagcctggacgtgctacagtcctggtgtgag
aagttggccgagatcatctggcagaaccggcagcagatccgcagggctgagcacctctgc
cagcagctgcccatccccggcccagtggaggagatgctggccgaggtcaacgccaccatc
acagacatcatctcagccctggtgaccagcacattcatcattgagaagcagccccctcag
gtcctgaagacccagaccaagtttgcagccaccgtgcgcctgctggtgggcgggaagctg
aacgtgcacatgaaccccccccaggtgaaggcgaccatcatcagtgagcagcaggccaag
tctctgctcaagaacgagaacacccgcaatgattacagcggcgagatcttgaacaactgc
tgcgtgatggagtaccaccaagccacgggcacccttagtgcccacttcaggaacatgtcc
ctgaaacgaattaagaggtcagaccgtcgtggcgcagagtcggtgacagaagaaaagttt
acaattctgtttgaatcccagttcagcattggtggaaatgagctggtttttcaagtcaag
accctgtccctgccagtggtggtgattgttcatggcagccaggacaacaatgcgacagcc
accgttctctgggacaatgcttttgcagagccgggcagagtgccatttgccgtgcctgac
aaagtgctgtggccgcagctgtgtgaggcgctcaacatgaaattcaaggccgaagtgcag
agcaaccggggcctgaccaaggagaacctcgtgttcctggcgcagaaactgttcaacaac
agcagcagccacctggaggattacagcggcctgtccgtgtcctggtcccagttcaacagg
gagaatttaccaggacggaattacactttctggcaatggtttgatggcgtgatggaagtg
ttaaaaaaacatctcaagcctcattggaatgatggggccattttggggtttgtaaacaag
caacaggcccatgacctactcattaacaagccagatgggaccttcctgctgagattcagt
gactcagaaattggcggcatcaccattgcttggaagtttgattctcaggaaagaatgttt
tggaatctgatgccttttaccaccagagacttctccattcggtctctagccgaccgcttg
ggagacttgaattaccttatctatgtgtttcctgaccggccaaaagatgaagtatactcc
aaatactacacaccagttccctgcgagtctgctactgctaaagccgttgatggatacgtg
aagccacagatcaagcaagtggtccctgagtttgtgaacatatctgcagatgccggtggg
ggcagcagcgccacgtacatggaccaggccccctccccagccgtgtgcccccaggctcac
tataacatgtacccacagaaccctgactcagtccttgacaccgatggggacttcgatctg
gaggacacgatggacgtggcacggcgtgtggaggagctcctgggccggccgatggacagt
cagtggatcccgcacgcacagtcgtga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100388917Help
Entry
100388917         CDS       T03264                                 

Gene name
STAT5A
Definition
(RefSeq) signal transducer and activator of transcription 5A
  KO
K11223  signal transducer and activator of transcription 5A
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04012  ErbB signaling pathway
cjc04217  Necroptosis
cjc04630  Jak-STAT signaling pathway
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04917  Prolactin signaling pathway
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc05161  Hepatitis B
cjc05162  Measles
cjc05166  Human T-cell leukemia virus 1 infection
cjc05200  Pathways in cancer
cjc05203  Viral carcinogenesis
cjc05220  Chronic myeloid leukemia
cjc05221  Acute myeloid leukemia
cjc05223  Non-small cell lung cancer
Module
cjc_M00684  JAK-STAT signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100388917 (STAT5A)
   04630 Jak-STAT signaling pathway
    100388917 (STAT5A)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100388917 (STAT5A)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100388917 (STAT5A)
   04659 Th17 cell differentiation
    100388917 (STAT5A)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100388917 (STAT5A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100388917 (STAT5A)
   05203 Viral carcinogenesis
    100388917 (STAT5A)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100388917 (STAT5A)
   05220 Chronic myeloid leukemia
    100388917 (STAT5A)
   05223 Non-small cell lung cancer
    100388917 (STAT5A)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100388917 (STAT5A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100388917 (STAT5A)
   05162 Measles
    100388917 (STAT5A)
   05161 Hepatitis B
    100388917 (STAT5A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100388917 (STAT5A)
Transcription factors [BR:cjc03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   STAT
    100388917 (STAT5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2
Motif
Other DBs
NCBI-GeneID: 100388917
NCBI-ProteinID: XP_008995855
Ensembl: ENSCJAG00000000426
UniProt: U3BQA4
Position
5
AA seq 795 aa AA seqDB search
MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRAQATQL
LEGLVQELQRKAEHQVGEDGFLLKIKLGHYATQLQKTYDRCPMELVRCIRHILYNEQRLV
REANNCSSPAGILVDTMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFATLGQLSPQERLSRETALQQKQVSLEAWLQREAQTLQQYRLELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRADRRGAESVTEEKFTVLFESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATA
TVLWDNAFSEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFTN
SSSHLEDYSGLSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPERNLWNLKPFTTRDFSIRSLADRL
GDLNYLIYVFPDRPKDEVFSKYYTPVLAKAVDGYVKPQIKQVVPEFVNISADAGGGSSAT
YMDQAPSPAVCPQAHYNMYPQNPDPVLDQDGEFDLDETMDVARHVEELLRRPMDSLDPRL
SPPAGLFTSARGSLS
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atggcagggtggatccaggcccagcagctgcagggagatgcgctgcgccagatgcaggtg
ctgtatggccaacacttccccatcgaggtccgacactacttggcccagtggattgagagc
cagccatgggatgccattgacttggacaatccccaggacagagcccaagccacacagctc
ctagagggcctggtgcaggagctgcagaggaaggcagagcaccaggtgggggaagatggg
tttttactgaagatcaagctgggacactacgccacgcagctccagaaaacatatgaccgc
tgccccatggaactggtccgctgcatccggcacattctgtacaatgaacagaggttggtc
cgagaagccaacaattgtagctctccagctgggatcctggttgacaccatgtcccagaaa
cacctgcagatcaaccagacgtttgaggagctgcgactggtcacacaggacacagagaat
gagctgaagaagctgcagcagactcaggagtacttcatcatccagtaccaggagagcctg
aggatccaagctcagtttgccacgctgggccagctgagcccccaggagcgtctgagccgg
gagacagcgctccagcagaagcaggtgtccctggaggcctggctgcagcgcgaggcacag
acgctacagcagtaccgcctggagctggccgagaagcaccagaagaccctgcagctgctg
cggaagcaacagaccatcatcctggatgacgagctgatccagtggaagcggcggcagcag
ctggccgggaacggcgggccccccgagggcagcctggacgtgctacagtcctggtgtgag
aagttggccgagatcatctggcagaaccggcagcagatccgcagggctgagcacctctgc
cagcagctgcccatccccggcccagtggaggagatgctggccgaggtcaacgccaccatc
acggacatcatctcagccctggtgaccagcacattcatcattgagaagcagccccctcag
gtcctgaagacccagaccaagtttgcagccaccgtgcgcctgctggtgggcgggaagctg
aacgtgcacatgaaccccccgcaggtgaaggcgaccatcatcagtgagcagcaggccaag
tctctgctcaagaacgagaacacccgcaacgagtgcagtggtgagatcctgaacaactgc
tgcgtgatggagtaccaccaagccacgggcaccctcagtgcccacttcaggaacatgtca
ctgaagaggatcaagcgtgctgaccggcggggtgcagagtccgtgacggaggagaagttc
acggtcctgtttgagtctcagttcagtgtcggcagcaatgagcttgtgttccaggtgaag
actctgtccctacctgtggttgtcatcgtccacggcagccaggaccacaatgccacagcc
actgtactgtgggacaacgccttttctgagccgggcagagtgccatttgccgtgcctgac
aaagtgctgtggccgcagctgtgtgaggcgctcaacatgaaattcaaggccgaagtgcag
agcaaccggggcctgaccaaggagaacctcgtgttcctggcgcagaaactgttcaccaac
agcagcagccacctggaggattacagcggcctgtccgtgtcctggtcccagttcaacagg
gagaacttgcctggctggaactacaccttctggcagtggtttgatggggtgatggaagtg
ttgaagaagcaccacaagccccactggaatgacggggccatcctaggttttgtgaataag
caacaggctcatgatctgctcatcaacaagcccgacgggaccttcttgttgcgctttagt
gactcagaaattgggggcatcaccatcgcctggaagtttgactccccggaacgcaacctg
tggaacctgaagccgttcactacgagggatttctccatcaggtccctggctgaccggctg
ggagacctgaactatctgatctatgtgtttcctgaccgccccaaggatgaggtcttctcc
aagtactatactcctgtgctggctaaagccgttgatggatacgtgaagccacagatcaag
caagtggtccctgagtttgtgaacatatctgcagatgccggtgggggcagcagcgccacg
tacatggaccaggccccctccccagccgtgtgcccccaggctcactataacatgtaccca
cagaaccctgaccctgtcctcgaccaggatggagaattcgacctggatgagaccatggat
gtggccaggcacgtggaggaactcttacgccgaccaatggacagtcttgacccccgcctc
tcaccccctgctggtcttttcacctctgccagaggctccctctcatga

DBGET integrated database retrieval system