KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100388587
Entry
100388587         CDS       T03264                                 
Symbol
PDE1B
Name
(RefSeq) phosphodiesterase 1B
  KO
K13755  calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase [EC:3.1.4.17]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00230  Purine metabolism
cjc01100  Metabolic pathways
cjc04020  Calcium signaling pathway
cjc04740  Olfactory transduction
cjc04742  Taste transduction
cjc04924  Renin secretion
cjc05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100388587 (PDE1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100388587 (PDE1B)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    100388587 (PDE1B)
  09157 Sensory system
   04740 Olfactory transduction
    100388587 (PDE1B)
   04742 Taste transduction
    100388587 (PDE1B)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100388587 (PDE1B)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     100388587 (PDE1B)
SSDB
Motif
Pfam: PDEase_I PDEase_I_N
Other DBs
NCBI-GeneID: 100388587
NCBI-ProteinID: XP_002752607
Ensembl: ENSCJAG00000019038
UniProt: U3DNA4
Position
9:43560995..43592320
AA seq 536 aa
MELSPRSPPEMLEESDCPSPLELKSAPSKKMWIKLRSLLRYMVKQLENGEVNIEELKKNL
EYTASLLEAVYIDETRQILDTEDELQELRSDAVPSEVRDWLASTFTQQARAKGRRAEEKP
KFRSIVHAVQAGIFVERMFRRTYTSVGPTYSTAVLNCLKNLDLWCFDVFSLNRAADDHAL
RTIVFELLTRHSLISRFKIPTVFLMSFLDALETGYGKYKNPYHNQIHAADVTQTVHCFLL
RTGMVHCLSEIEVLAIIFAAAIHDYEHTGTTNSFHIQTKSECAILYNDRSVLENHHISSV
FRLMQDDEMNIFINLTKDEFVELRALVIEMVLATDMSCHFQQVKTMKTALQQLERIDKPK
ALSLLLHAADISHPTKQWLVHSRWTKALMEEFFRQGDKEAELGLPFSPLCDRTSTLVAQS
QIGFIDFIVEPTFSVLTDVAEKSVQPLSDEDSKSKNQPSFQWRQPSLDVEVGDPNPDVAS
FRSTWLKHTQENKQKWKERAASGITNQMSIDELSPCEEEAPPSPAEDEHNQNGNLD
NT seq 1611 nt   +upstreamnt  +downstreamnt
atggagctgtccccccgcagtcctccggagatgctggaggagtcggattgcccgtcaccc
ctggagctgaagtcggcccccagcaagaagatgtggattaagcttcggtctctgctgcgc
tacatggtgaagcagttggaaaatggggaggtaaacatcgaagagctgaagaaaaacctg
gagtacaccgcctctctgctggaggctgtctacatagatgagacacggcaaatcctggac
acggaggacgagctgcaggagctgcggtcagatgccgtgccttcggaggtgcgggactgg
ctggcctccaccttcacccagcaggcccgggccaaaggccgccgagcagaggagaagccc
aagttccgaagcattgtgcatgctgtacaggcggggatcttcgtggaacggatgttccgg
agaacatacacctctgtgggccccacttattctactgctgtcctcaactgtctcaagaac
ctggatctctggtgctttgatgtcttttccttgaaccgggcagcagatgaccatgccctg
aggaccattgtttttgagttgctgactcggcatagcctcatcagtcgctttaagattccc
actgtgtttttgatgagtttcctggatgccttggagacaggctacgggaagtacaagaat
ccttaccacaatcagatccatgcagctgatgttacccagacagtccattgcttcctgctc
cgcacggggatggtgcactgcctgtcggagattgaggtcctggccatcatctttgctgca
gccatccatgattatgagcacacgggcactaccaacagcttccacatccagaccaagtca
gaatgtgccatcctgtacaatgatcgttcagtgctggagaatcaccacatcagctctgtt
ttccgactgatgcaggatgacgagatgaacattttcatcaacctcaccaaggatgagttt
gtagagctccgagccctggtcattgagatggtgttggccacagacatgtcttgccatttc
cagcaagtgaagaccatgaagacggccttgcagcagctggagaggattgacaagcccaag
gccctgtctctactgctccatgctgctgacatcagccacccaaccaagcagtggttggtc
cacagccgctggaccaaggccctcatggaggaattcttccgccagggtgacaaggaggca
gagttgggcctgcccttttctccgctctgtgaccgcacttccaccctggtggcacagtct
cagatagggttcatcgacttcattgtggagcccacgttctctgtgctgactgatgtggca
gagaagagtgttcagcccctgtcggatgaggactccaagtctaaaaaccagcccagcttt
cagtggcgccagccctctcttgatgtggaagtgggagaccctaaccctgatgtggccagc
tttcgttccacctggctcaagcacacacaggagaacaagcagaaatggaaggaaagggca
gctagtggcatcaccaaccagatgtccattgacgagctgtccccctgtgaagaagaggcc
ccaccctcccctgctgaagatgaacacaaccagaatgggaatctggattag

DBGET integrated database retrieval system