KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100388808Help
Entry
100388808         CDS       T03264                                 

Definition
(RefSeq) DNA repair protein RAD51 homolog 3
  KO
K10870  RAD51-like protein 2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03440  Homologous recombination
cjc03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    100388808
   03460 Fanconi anemia pathway
    100388808
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cjc03400]
    100388808
DNA repair and recombination proteins [BR:cjc03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecA family proteins
     100388808
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     100388808
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rad51 ATPase AAA_25 RecA HHH_5 AAA_24 AAA_18 HTH_10
Motif
Other DBs
NCBI-GeneID: 100388808
NCBI-ProteinID: XP_008988631
Position
5
AA seq 227 aa AA seqDB search
MQRDLLRFPLSSAVRVKLVSAGFQTAEELLEVKPSELSKEVGISKEEALETLQIIRRECL
TNKPRYAGTSESGKKCTALELLEQEHIQGSIITFCSALDNILGGGVPLMKTTEICGAPGI
GKTQLCVQLAVDVQIPECFGGVAGEAVFIDTEGSFMVDRVVDLATACIQHLQLIAEKHKG
EEHRKALEDFTLENILSHIYYFRCRDYTXLLAQVYLLPDFLSEHSQV
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgggatttactgcgtttcccgctgtcttcagcggtgcgggtgaagttggtgtct
gcgggtttccagactgctgaggaactcctggaggtgaaaccctccgagcttagcaaagaa
gttgggatatctaaagaggaagccttagaaactctgcaaattataagaagagaatgtctc
acaaataaaccaagatatgctggtacatctgagtcaggcaagaagtgtacagcactggaa
cttcttgagcaggagcatatccagggctccataattaccttctgttcagcactagataat
attcttgggggtggagtacccttaatgaaaacaacagaaatttgtggtgcaccaggcatt
ggaaaaacacaattatgtgtgcagttggcagtagatgtgcagataccggaatgttttgga
ggagtggcaggtgaagcagtttttattgatacagagggaagttttatggttgatagagtg
gtagaccttgctactgcctgcattcaacaccttcagcttatagcagaaaaacacaaggga
gaggaacatcgaaaagctttggaggatttcactcttgaaaatattctttcccatatttat
tattttcgctgtcgtgactacacanngttactggcacaagtttatcttcttccagatttc
ctttcagaacactcacaggtatga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100405138Help
Entry
100405138         CDS       T03264                                 

Definition
(RefSeq) DNA repair protein RAD51 homolog 3-like
  KO
K10870  RAD51-like protein 2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03440  Homologous recombination
cjc03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    100405138
   03460 Fanconi anemia pathway
    100405138
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cjc03400]
    100405138
DNA repair and recombination proteins [BR:cjc03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecA family proteins
     100405138
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     100405138
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rad51 AAA_25 ATPase RecA HHH_5 AAA_24
Motif
Other DBs
NCBI-GeneID: 100405138
NCBI-ProteinID: XP_017824775
Position
Un
AA seq 434 aa AA seqDB search
MTAASPNRPQWRGARLTTAWPAPSSLRLTSRRTPGEGVRSLPAPRLAAEPVQLREKTFRF
EMQRDLLSFPLSPAVRVKLVSAGFQTAEELLEVKPSELSKEVGISKEEALETLQIIRREC
LTNKPRYAGTSESGKKCTALELLEQEHIQGSIITFCSALDNILGGGVPLMKTTEICGAPG
IGKTQLCVQLAVDVQIPECFGGVAGEAVFIDTEGSFMVDRVVDLATACIQHLQLIAEKHK
GEEHRKALEDFTLENILSHIYYFRCRDYTELLAQVYLLPDFLSEHSQVRLVIVDGIAFPF
RHDLDDLSLRTRLLNGLAQQMISLANNHRLAVILTNQMTTKIDKNQALLIPALGESWGHA
ATIRLIFHWDRKQRLATLYKSPSQKESTVLFQITPQGFRDTVITSACSLQTEDSLNTRNG
HEMQRKNCNPETNF
NT seq 1303 nt NT seq  +upstreamnt  +downstreamnt
atgactgcggcttcacctaacaggccacagtggagaggagcaaggctcacgaccgcgtgg
ccagccccttcctctttacgtctgacgtcacgccgtacgcccggcgagggtgtgcggagc
ttgcctgctccgcggttagccgctgagcctgtgcaactgcgcgagaagacgttccgcttt
gaaatgcagcgggatttgctgagtttcccgctgtctccagcggtgcgggtgaagttggtg
tctgcgggtttccagactgctgaggaactcctggaggtgaaaccctccgagcttagcaaa
gaagttgggatatctaaagaggaagccttagaaactctgcaaattataagaagagaatgt
ctcacaaataaaccaagatatgctggtacatctgagtcaggcaagaagtgtacagcactg
gaacttcttgagcaggagcatatccagggatccataattacattctgttcagcactagat
aatattcttgggggtggagtacccttaatgaaaacaacagaaatttgtggtgcaccaggc
attggaaaaacacaattatgtgtgcagttggcagtagatgtgcagataccggaatgtttt
ggaggagtggcaggtgaagcagtttttattgatacagagggaagttttatggttgataga
gtggtagaccttgctactgcctgcattcaacaccttcagcttatagcagaaaaacacaag
ggagaggaacatcgaaaagctttggaggatttcactcttgaaaatattctttcccatatt
tattattttcgctgtcgtgactacacagagttactggcacaagtttatcttcttccagat
ttcctttcagaacactcacaggttcgattggtgatagtggatggtattgcttttccattt
cgtcatgacctagatgacctgtctcttcgtactcggttattaaatggcctagcccagcaa
atgatcagtcttgcgaataatcacagattagctgtaattttaaccaatcagatgacaacc
aagattgataaaaatcaggccttgctcattcctgctttaggggaaagttggggacatgct
gctacaatacggctaatctttcattgggaccgaaagcaaaggttggcaacattgtacaag
tcacccagccagaaggaatccacagtactgtttcaaatcacacctcagggatttagagat
actgttattacttctgcatgttcattgcagacagaagattccttgaatacccggaacggt
cacgagatgcagaggaagaattgtaacccagaaacaaatttcc

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100896697Help
Entry
100896697         CDS       T03264                                 

Definition
(RefSeq) DNA repair protein RAD51 homolog 3-like
  KO
K10870  RAD51-like protein 2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03440  Homologous recombination
cjc03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    100896697
   03460 Fanconi anemia pathway
    100896697
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cjc03400]
    100896697
DNA repair and recombination proteins [BR:cjc03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecA family proteins
     100896697
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     100896697
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rad51
Motif
Other DBs
NCBI-GeneID: 100896697
NCBI-ProteinID: XP_008988630
Position
5
AA seq 112 aa AA seqDB search
MQLAVDVQIPECFGGVAGEAVFIDTEGSFMVDRVVDLATACIQHLHLIAEKHKGEEHRKA
LEGFTLENILSHIYYFRCRDYTELLAQVYLLPDFLSEHSQCLPPELITIGQV
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgcagttggcagtagatgtgcagataccggaatgttttggaggagtggcaggtgaagca
gtttttattgatacagagggaagttttatggttgatagagtggtagaccttgctactgcc
tgcattcagcaccttcaccttatagcagaaaaacacaagggagaggaacatcgaaaagct
ttggagggtttcactcttgaaaatattctttcccatatttattattttcgctgtcgtgac
tacacagagttactggcacaagtttatcttcttccagatttcctttcagaacactcacag
tgcctcccgccagagttgatcactattggccaggtatag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 103793239Help
Entry
103793239         CDS       T03264                                 

Gene name
RAD51C
Definition
(RefSeq) RAD51 paralog C
  KO
K10870  RAD51-like protein 2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03440  Homologous recombination
cjc03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    103793239 (RAD51C)
   03460 Fanconi anemia pathway
    103793239 (RAD51C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cjc03400]
    103793239 (RAD51C)
DNA repair and recombination proteins [BR:cjc03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecA family proteins
     103793239 (RAD51C)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     103793239 (RAD51C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rad51 AAA_25 ATPase RecA HHH_5 AAA_24 DnaB_C AAA_18
Motif
Other DBs
NCBI-GeneID: 103793239
NCBI-ProteinID: XP_017828108
Ensembl: ENSCJAG00000010858
Position
5
AA seq 367 aa AA seqDB search
MQRDLLRFPLSSAVRVKLVSAGFQTAEELLEVKPSELSKEVGISKDEALETLQIIRRECL
TNKPRYAGTSESGKKCTALELLEQEHIQGSIITFCSALDNILGGGVPLMKTTEICGAPGI
GKTQLCVQLAVDVQIPECFGGVAGEAVFIDTEGSFMVDRVVDLATACIQHLHLIAEKHKG
EEHQKALEDFTLENILSHIYYFRCRDYTELLAQVYLLPDFLSEHSQVRLVIVDGIAFPFR
HDLDDLSLRTRLLNGLAQQMISLANNHRLAVILTNQMTTKIDKNQALLIPALGESWGHAA
TIRLIFHWDLKQRLATLYKSPSQKESTVLFQITPQGFRDTIITSACSLQTEDSLNTRKRS
RDAEEEF
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgggatttgctgcgtttcccgctgtcttcagcggtgcgggtgaagttggtgtct
gcgggtttccagactgctgaggaactcctggaggtgaaaccctccgagcttagcaaagaa
gttgggatatctaaagatgaagccttagaaactctgcaaattataagaagagaatgtctc
acaaataaaccaagatatgctggtacatctgagtcaggcaagaagtgtacagcactggaa
cttcttgagcaggagcatatccagggctccataattaccttctgttcagcactagataat
attcttgggggtggagtacccttaatgaaaacaacagaaatttgtggtgcaccaggcatt
ggaaaaacacaattatgtgtgcagttggcagtagatgtgcagataccggaatgttttgga
ggagtggcaggtgaagcagtttttattgatacagagggaagttttatggttgatagagtg
gtagaccttgctactgcctgcattcagcaccttcaccttatagcagaaaaacacaaggga
gaggaacatcaaaaagctttggaggatttcactcttgaaaatattctttcccatatttat
tattttcgctgtcgtgactacacagagttactggcacaagtttatcttcttccagatttc
ctttcagaacactcacaggttcggttggtgatagtggatggtattgcttttccatttcgt
catgacctagatgacctgtctcttcgtactcggttattaaatggcctagcccagcaaatg
atcagtcttgcaaataatcacagattagctgtaattttaaccaatcagatgacaaccaag
attgataaaaatcaggccttgctcattcctgctttaggggaaagttggggacatgctgct
acaatacggctaatctttcattgggacctaaagcaaaggttggcaacattgtacaagtca
cccagccagaaggaatccacagtactgtttcaaatcacacctcagggatttagagatact
attattacttctgcatgttcattgcagacagaagattccttgaatacccggaaacggtca
cgagacgcagaggaagaattttaa

DBGET integrated database retrieval system