KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100388842Help
Entry
100388842         CDS       T03264                                 

Gene name
CCNB2
Definition
(RefSeq) cyclin B2
  KO
K21770  G2/mitotic-specific cyclin-B2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04068  FoxO signaling pathway
cjc04110  Cell cycle
cjc04114  Oocyte meiosis
cjc04115  p53 signaling pathway
cjc04218  Cellular senescence
cjc04914  Progesterone-mediated oocyte maturation
cjc05166  Human T-cell leukemia virus 1 infection
cjc05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100388842 (CCNB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100388842 (CCNB2)
   04114 Oocyte meiosis
    100388842 (CCNB2)
   04115 p53 signaling pathway
    100388842 (CCNB2)
   04218 Cellular senescence
    100388842 (CCNB2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100388842 (CCNB2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100388842 (CCNB2)
   05170 Human immunodeficiency virus 1 infection
    100388842 (CCNB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cjc03032]
    100388842 (CCNB2)
   03036 Chromosome and associated proteins [BR:cjc03036]
    100388842 (CCNB2)
DNA replication proteins [BR:cjc03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    100388842 (CCNB2)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    100388842 (CCNB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N Cyclin_C
Motif
Other DBs
NCBI-GeneID: 100388842
NCBI-ProteinID: XP_009003229
Position
10
AA seq 398 aa AA seqDB search
MALLRRPTVSSDLENIDTAVHSKAKSHVTIRRTVLEEIGNKVTTRAAQVAKKAQNSKVPF
QPTKTTNVNKQLKPTASVKPVQMEMLASKGPSPTPEDVSMKEENLCQAFSDALLCKIEDI
DNEDWENPQLCSDYVKDIYQYLRQLEVLQSINPHFLEERDXNGRMRAILVDWLVQVHSKF
RLLQETLYICVAIMDRFXQVQPVSRKKLQLVGITALLLASKYEEMFSPNIEDFVYITDNA
YTSSQIREMETLILKELKFELGRPLPLHFLRRASKAGEVDVQQHTLAKYLMELTLIDYDM
VHYHPSKVAAAASCLSQKVLGQGKWNLKQQYYTGYTENEVLEVMQHMAKNVVKVNENLTK
FIAVKNKYASSKLLKISTVPQLNSKTIKDLASPLMGRP
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggctctgctccgacgcccgacggtttccagtgatttggagaatatcgacactgctgtt
cattctaaagctaagagtcatgtgactattaggcgaacggttttagaagaaattggaaat
aaagttacaaccagagcagcacaagtagctaagaaagctcagaactccaaagtaccattt
caacccaccaaaacaacaaatgtcaacaaacaactgaaacccactgcttctgtgaaacca
gtacaaatggaaatgctggcttcaaagggtccttctcccacacctgaagatgtctccatg
aaggaagagaatctctgccaagctttttctgatgcgttgctttgcaaaattgaggacatt
gataacgaagattgggagaaccctcaactctgcagtgactacgttaaggatatctatcag
tatctcaggcagctggaggttttgcagtccataaacccgcatttcttagaggaaagagat
nataatggacgcatgcgtgccatcctggtagactggctggtgcaagtccactccaagttt
aggcttctgcaggagactctgtacatatgtgttgccattatggatcgattttaacaggtt
cagccagtttcccggaagaagcttcagttagttgggattactgctctgctcttggcttcc
aagtatgaggagatgttttctccaaatattgaagacttcgtttacatcacagacaatgct
tataccagttcccaaatccgagaaatggaaactctcattttgaaagaactgaaatttgag
ttgggtcgacccttgccactacacttcttaaggcgagcatcaaaagccggggaggttgat
gttcaacagcacactttagccaaatatttgatggagctgactctcattgactacgatatg
gtgcattatcacccttctaaggtagcagcagctgcttcctgcttgtctcagaaggttcta
ggacaaggaaaatggaacttaaagcagcagtactacacaggatacacagagaatgaagta
ctggaagtcatgcagcacatggccaaaaacgtggtcaaagtgaacgaaaacttaaccaaa
ttcatcgccgtcaagaataagtatgcaagcagcaaacttctgaagatcagcacagtccct
cagctgaactcgaaaaccatcaaagaccttgcctccccactcatgggaaggccttag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100390365Help
Entry
100390365         CDS       T03264                                 

Gene name
CCNB3
Definition
(RefSeq) cyclin B3
  KO
K21771  G2/mitotic-specific cyclin-B3
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04068  FoxO signaling pathway
cjc04110  Cell cycle
cjc04218  Cellular senescence
cjc04914  Progesterone-mediated oocyte maturation
cjc05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100390365 (CCNB3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100390365 (CCNB3)
   04218 Cellular senescence
    100390365 (CCNB3)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100390365 (CCNB3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100390365 (CCNB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cjc03032]
    100390365 (CCNB3)
   03036 Chromosome and associated proteins [BR:cjc03036]
    100390365 (CCNB3)
DNA replication proteins [BR:cjc03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    100390365 (CCNB3)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    100390365 (CCNB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_C Cyclin_N
Motif
Other DBs
NCBI-GeneID: 100390365
NCBI-ProteinID: XP_017823820
Position
X
AA seq 152 aa AA seqDB search
MEIHILYVLKFDINIPVAYHFLRRYAKCIHTSMKTLTLSRYICEMSLQEYDYVQEKASKL
AAASLLLALYMRNLGHWVPILEYYSGYKISELYSVVRRLNKLLTFTSYCNLKTVYSKYSH
PVYFEVTKIPTLDTLKLEEVLNYDCMAEDLVF
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggaaatccacatcctgtacgtcctcaaatttgacatcaacattcccgttgcctatcat
tttctgcgcagatatgctaagtgtatccacaccagtatgaagacactgaccttgtcccgc
tacatctgtgagatgagtctgcaagaatacgactatgtccaggagaaagcttccaagcta
gctgctgcctccttactcctggccctctacatgaggaatctcggacactgggttcccatc
ctggagtattacagtggctacaagatctctgagctttactctgtggtcagacggctgaac
aaactgctgactttcacttcttactgtaatctcaagactgtgtattccaagtattctcac
ccggtctactttgaagtcaccaaaatccccaccttggatacgttgaagctggaggaggtt
ctgaactacgattgtatggctgaggacctggtattctag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100391291Help
Entry
100391291         CDS       T03264                                 

Gene name
CCNB1
Definition
(RefSeq) cyclin B1
  KO
K05868  G2/mitotic-specific cyclin-B1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04068  FoxO signaling pathway
cjc04110  Cell cycle
cjc04114  Oocyte meiosis
cjc04115  p53 signaling pathway
cjc04218  Cellular senescence
cjc04914  Progesterone-mediated oocyte maturation
cjc05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100391291 (CCNB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100391291 (CCNB1)
   04114 Oocyte meiosis
    100391291 (CCNB1)
   04115 p53 signaling pathway
    100391291 (CCNB1)
   04218 Cellular senescence
    100391291 (CCNB1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100391291 (CCNB1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100391291 (CCNB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cjc03032]
    100391291 (CCNB1)
   03036 Chromosome and associated proteins [BR:cjc03036]
    100391291 (CCNB1)
DNA replication proteins [BR:cjc03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    100391291 (CCNB1)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    100391291 (CCNB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N Cyclin_C
Motif
Other DBs
NCBI-GeneID: 100391291
NCBI-ProteinID: XP_002744945
Ensembl: ENSCJAG00000016075
UniProt: F7I0H4
Position
2
AA seq 429 aa AA seqDB search
MALRVTRNSKINAENTTKISMAGAKRVPMAPAATSKPGLRPRTALGDIGNKVSEQLQTKM
PMKKEGKPSATGKVIAKKLPKPLEKVPMLGPVPVSQPVPEPEPEPVKEEKLSPEPILVDT
PSLSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGVDPNLCSEYVKDIYAYLRQLEEE
QAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKML
QLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRPLPLH
FLRRASKIGEADVDQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDDGEWTPT
LQHYLSYTEESLLPVMQHLAKNIVMVNQGLTKHMTIKNKYATSKHAKISTLAQLNSALVQ
DLAKAVAKV
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggcgctccgagtcaccaggaactcgaaaataaatgctgaaaatacgacgaagatcagt
atggcaggcgcaaagcgcgtgcctatggcccctgctgcaacctccaagcccggactgagg
ccaagaacagctcttggggacattggtaacaaagtcagtgaacagctacagaccaaaatg
cctatgaaaaaggagggaaaaccttcagctactggaaaagttattgctaaaaaactacca
aaacctctggaaaaggtacctatgctggggccagtgccggtgtcccagccagtgccagag
ccagaacctgagcctgttaaagaagaaaaactttcgcctgagcctattttggttgacact
ccctctctaagcccaatggaaacatctggatgtgcccctgcagaagaagacctatgtcag
gctttctctgatgtaattcttgcagtaaatgatgtggatgcagaagatggagtggatcca
aacctttgtagtgaatatgtgaaagatatttatgcttatctgagacaacttgaggaagag
caagcagtcagaccgaaatacctactgggtcgggaagtcactggaaacatgagagccatc
ctaattgactggctagtacaggtccagatgaaattcaggttgttgcaggagaccatgtac
atgactgtctccattattgatcggttcatgcagaataattgtgtgcccaagaagatgctg
caactggttggtgtcactgccatgtttattgccagcaaatatgaagaaatgtaccctcca
gaaattggtgactttgcttttgtgactgacaacacttacactaagcaccagatcagacag
atggaaatgaagattctaagagctttaaactttggtctgggtcggcctctacctttgcac
ttccttcggagagcatctaagattggagaggctgatgttgaccaacatactttggccaaa
tacctgatggaactaactatgttggactatgatatggtgcactttcctccttctcaaatt
gcagcaggagctttttgcttagcactgaaaattctggatgatggtgaatggacaccaact
ctacagcattacctgtcatacactgaagaatcccttcttccagttatgcagcacctggct
aagaatatagtcatggtaaatcaagggcttacaaagcacatgactatcaagaacaagtat
gctacgtcgaaacatgctaagatcagcactctagcacagctgaattctgcactagttcaa
gatttagccaaggctgtggcaaaggtgtaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100394742Help
Entry
100394742         CDS       T03264                                 

Definition
(RefSeq) G2/mitotic-specific cyclin-B3
  KO
K21771  G2/mitotic-specific cyclin-B3
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04068  FoxO signaling pathway
cjc04110  Cell cycle
cjc04218  Cellular senescence
cjc04914  Progesterone-mediated oocyte maturation
cjc05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100394742
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100394742
   04218 Cellular senescence
    100394742
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100394742
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100394742
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cjc03032]
    100394742
   03036 Chromosome and associated proteins [BR:cjc03036]
    100394742
DNA replication proteins [BR:cjc03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    100394742
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    100394742
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N Grg1 PRTase_1 RAWUL
Motif
Other DBs
NCBI-GeneID: 100394742
NCBI-ProteinID: XP_008988934
Position
X
AA seq 1158 aa AA seqDB search
AFQCQPAQPKKEANKEFVKDVSKKINRNTCALGLAIKSKRNLKWHKLEFTPIVASTTLAP
NIMEKPLILDITTTSKTPSTEEASLFRKPLVLKEEPTTEDKILIKKSLSLKKCSNHEHMS
LLEKPQPQQEESDSDDDFVIEPVTFKKTHKTEEEAITNKTLSLKKMYASQGKQSCQEELL
ALQDVNIEEDSFFMKSTSFKKKPKTEESISTKKLSSLKKKCTIYGKMCHFKKPLVLQTTI
SGEMSSIKEPLSLQKKPTTEKETLFQEPSALQEKHTTEHEMSISKTSLALQEKASFKEDS
LVKKSLPFNKKPSTEEAIMRSFILKKQCMTQQKRSHLKPLVLQEITSGEKSLITKPLSIK
EKPTTEKLFSQEPSVLQEKHTTQGEVDHLKKPCALQQNSDSEDDFMELVSFEKKHTTKES
TSMTKPLSLKNEKDATQGKMSCLKHPLILPKTISGDKSLIKEPLPFKKKPTTEKESFFQE
PSALQEKHTTQREVSILKEPLSLLKSPTEESLFDEALACKKCTIEEATPTKQALILKRKH
TTQGTVSQLKKPLVSQTTSGEKSLIEEPLSFKEEKVPLKKKYTTQAMMSVWPELLNFQDD
KFNNSIGDDKSSFFMEPVSFRKNLMTEETVLTKTSLSLQKKNITQEKMSLLEKPLVLQKI
TSEEETFYKKLLPFKVKSTTEEKFLFQEPSALKEKHTTLQEVSSSRESLPIQETTTTEEE
FSQELFSLHVKHTNKSGSLFQEASVLQEKAATEEDSLKKLLALQERSTVEEDEFLISRPL
VLKKAHSAEAATNIDTQLSLKERSTAQGKVFLLEKQLALNENINEKEFLINSPLALEGYP
SIEEGETLFKKLLAMEEKPSIEKEAVLKEPTIDTEAHFKETLALQEKPSIEHQAFFKQHL
ALCEKPSTEKETIFKVSLVLQEKSIIEKETLFKEPLPLQMSTMNEAFLFKDMTTLNEKPT
TGKELSFKELLTLQESTTCKKDIFLKTFSIPQVGTSPYGSSTICESVTGKSNITTITKSS
ACASDEPFSPQAKQAPKEPIIPQEDTAEDNSDASFNPVYVKEIFSYMKEREEQFIVTDYM
NMQIEITGDMRAILVDWLVEVQVSFEMTHETLYLAVKLVDLYLMKAVCRKDKLQLLGAAA
LMIAAKFEVSLSPYGLEN
NT seq 3477 nt NT seq  +upstreamnt  +downstreamnt
gcttttcaatgtcaacctgcccagcccaagaaagaagccaataaagagtttgtaaaagat
gtttccaagaagataaacagaaacacttgtgctcttggattggccataaagagtaaacgg
aatctaaaatggcataaactggaattcacaccaatagtagcttctactaccttggcacca
aacattatggagaaaccactcattctagacataaccaccacctctaaaacacccagtact
gaggaggcatctctcttcagaaagccattagttttaaaagaggaacccactaccgaggat
aaaatccttatcaagaagtcattatctttaaagaagtgctcaaatcatgagcacatgtcc
ctattggaaaagccacagccccagcaggaggagagtgacagtgatgatgattttgttata
gagccagtgacttttaagaagacacataaaactgaggaggaagccatcaccaataagaca
ttatccttaaagaagatgtatgcaagtcaggggaagcagtcctgccaggaagagttgttg
gctttgcaggatgtcaatattgaagaggattccttctttatgaagtcaacgagttttaag
aagaagcctaaaactgaggagtcaatctctaccaaaaagctctcatctttaaagaagaaa
tgtaccatttatgggaagatgtgccactttaagaagccactagtattgcagacaaccatc
tctggagagatgtcctccattaaggagccattgtcccttcagaaaaaacctaccactgag
aaggagacccttttccaagagccatctgcattgcaagagaagcataccactgaacatgag
atgtccatctcgaagacatcattagccttgcaggagaaggccagctttaaagaggattcc
cttgttaagaagtcattaccctttaataagaagcctagcactgaggaggcaatcatgagg
tcatttattttaaagaagcagtgcatgactcagcaaaagaggtcccacttgaagccatta
gtattgcaggagatcacctctggagagaagtcactcattacaaagccattgtccattaaa
gaaaagcctactactgagaagcttttttcccaagaaccatctgtattacaagagaagcac
accactcagggggaggtagaccacttgaaaaagccatgcgcattgcagcagaatagtgac
agtgaagatgactttatggagctagtttcctttgagaagaagcatactaccaaggagtca
acctccatgacaaagccattatctttaaaaaatgagaaagatgccacacagggaaagatg
tcctgcttgaagcatccactaatattgccgaagaccatctctggggataaatcactgatt
aaggagccattgccctttaagaagaagcctactactgagaaggagtcctttttccaggaa
ccatctgcattgcaagagaagcacaccactcagagggaggtatccatcttaaaggagccc
ctgtccttgctaaagtctccaactgaggagtcactttttgatgaggctttggcttgtaaa
aagtgtaccattgaggaggcaactcccaccaagcaggctttaattttaaagaggaagcat
accactcaggggacagtgtcccagttgaagaaaccactagtatcacagaccacctctgga
gagaagtcacttattgaggagccattgtcctttaaagaagaaaaagtgcctttaaagaag
aagtacaccactcaagcgatgatgtctgtctggccagaactgttgaactttcaggacgat
aagttcaacaactctattggtgatgataagagttctttctttatggagccagtgtcattt
aggaagaaccttatgactgaagagacagtacttaccaagacatcattgtcgttacagaaa
aagaacattactcaggagaagatgtcactgttagagaagccactggtcttgcagaagatc
acttctgaggaggaaacattctataagaagctgttgccctttaaagtgaaatctacaact
gaagaaaagtttctcttccaggaaccatctgcattgaaagagaagcacacaaccttgcag
gaagtgtcctcctcaagagagtcattgcccatccaggagacaactaccactgaggaggaa
ttctctcaggaactattttcattgcatgttaagcataccaacaaaagtgggtccctcttc
caggaggcttcggtcttgcaagagaaggctgctaccgaagaggattccttgaagaagctg
ttggccttgcaggagagaagcaccgtggaagaagatgagttccttatcagtaggccattg
gttctgaagaaggcgcattctgctgaggcagccacaaacatagatacacaattatcttta
aaggagcggtccactgctcagggaaaagtgttcctcttggagaagcagttggctttgaat
gagaacatcaatgaaaaagaattccttattaactcgccactggccttggaggggtatccc
agcattgaggagggggagaccctcttcaagaaacttttggccatggaggagaagcctagc
attgagaaggaggctgtcctcaaggagcccactattgacacagaagctcactttaaggaa
actttggccttgcaggagaagcccagcattgagcatcaggccttctttaagcaacacttg
gctttgtgtgagaagcccagcactgagaaggagaccattttcaaggtgtccttggttttg
caggagaagtccatcattgagaaagagaccctcttcaaagagccattacccttgcagatg
tctaccatgaatgaggcattcctcttcaaagatatgacaactctgaatgagaaacccacc
actgggaaggaattgtctttcaaggagctattgaccttacaagagagtaccacctgcaag
aaagacatctttctcaaaacattctcgatcccccaagttggaaccagcccatatgggtct
agcaccatttgtgaatccgtaacaggcaagtctaacattacaaccatcaccaagtccagt
gcatgtgcttctgatgaacctttctcaccacaggccaagcaagcaccaaaggagccgata
atcccacaggaagatactgccgaggacaacagtgatgcaagtttcaacccagtatatgtc
aaggaaatcttcagttacatgaaggagagagaggaacagtttatagttacagattacatg
aacatgcagattgaaatcaccggtgacatgagggccattcttgtggactggttggtagag
gtgcaggtgtcctttgagatgacccatgagaccctgtacttggcagtgaaactggtggat
ctctacctaatgaaggcagtatgcaggaaggataagttacaactccttggtgctgctgcc
ttaatgattgcagcaaaatttgaggtgagcctgagtccctatggcctggagaactaa

DBGET integrated database retrieval system