KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100388876
Entry
100388876         CDS       T03264                                 
Symbol
COPS5
Name
(RefSeq) COP9 signalosome subunit 5
  KO
K09613  COP9 signalosome complex subunit 5 [EC:3.4.-.-]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cjc01002]
    100388876 (COPS5)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cjc04121]
    100388876 (COPS5)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-
    3.4.-.-
     100388876 (COPS5)
Peptidases and inhibitors [BR:cjc01002]
 Metallo peptidases
  Family M67
   100388876 (COPS5)
Ubiquitin system [BR:cjc04121]
 Deubiquitinating enzyme (DUB)
  UBL-specific proteases (ULPs)
   COP9 signalosome (CSN) complex
    100388876 (COPS5)
SSDB
Motif
Pfam: JAB CSN5_C Prok-JAB UPF0172
Other DBs
NCBI-GeneID: 100388876
NCBI-ProteinID: XP_002759014
Ensembl: ENSCJAG00000004632
Position
16:complement(19380647..19400845)
AA seq 390 aa
MVCTNCTSGSRCHGCPKSLVKSLLPWGGGSKAHTRRPSEVKLSLGCGYDSFSVSSAMAAS
GSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLK
MVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAYIENA
KQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLG
AFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNK
YWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSEDKLAKAT
RDSCKTTIEAIHGLMSQVIKDKLFNQINIS
NT seq 1173 nt   +upstreamnt  +downstreamnt
atggtctgtactaactgcacctccggttctaggtgtcatggctgccccaagagtctagtt
aagagtttgctcccgtggggcggagggtccaaggcccacaccaggagacctagcgaggta
aagttgtcccttggttgtggatacgacagcttctccgtttcctcggcgatggcggcgtcc
gggagcggtatggcccagaaaacctgggaattggccaacaacatgcaggaagctcagagt
atcgatgaaatctacaaatacgacaagaagcagcagcaagaaatcctggcggcgaagccc
tggactaaggatcaccattactttaagtactgcaaaatctcagcattggctctactgaag
atggtgatgcacgccagatcaggaggcaacttagaagtgatgggtctgatgctaggaaag
gtggatggtgaaaccatgatcattatggacagttttgctttgcctgtggagggcactgaa
acccgagtaaatgcacaggctgctgcatatgagtacatggccgcatatatagaaaatgct
aaacaggttggtcgccttgaaaatgcaattgggtggtatcatagccaccctggctatggc
tgctggctttctgggattgatgttagtactcagatgctcaatcagcagttccaggaacca
tttgtagcagtggtgattgatccaacaagaacgatatctgcagggaaagtgaatcttggc
gcctttaggacatacccaaagggctacaaacctcctgatgaaggaccttctgagtaccag
actatcccacttaataaaatagaagactttggtgtacactgcaaacaatattatgcctta
gaggtctcatatttcaaatcctctttggatcgaaaattgctcgagctgttgtggaataaa
tactgggtgaatacattgagttcctctagcttgcttactaatgcagactataccactggt
caggtattcgatttgtctgaaaagttagagcagtcagaagcccagctgggacgagggagt
ttcatgttgggtttagaaacgcatgaccgaaaatcagaagacaaacttgccaaagctacg
agagacagctgtaaaactaccatagaagctatccatggattgatgtctcaggttattaag
gataaactgtttaatcaaattaacatctcttaa

DBGET integrated database retrieval system