KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100388927Help
Entry
100388927         CDS       T03264                                 

Gene name
TNFRSF13C
Definition
(RefSeq) TNF receptor superfamily member 13C
  KO
K05151  tumor necrosis factor receptor superfamily member 13C
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04064  NF-kappa B signaling pathway
cjc04672  Intestinal immune network for IgA production
cjc05166  Human T-cell leukemia virus 1 infection
cjc05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100388927 (TNFRSF13C)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100388927 (TNFRSF13C)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    100388927 (TNFRSF13C)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    100388927 (TNFRSF13C)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100388927 (TNFRSF13C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:cjc04050]
    100388927 (TNFRSF13C)
   04090 CD molecules [BR:cjc04090]
    100388927 (TNFRSF13C)
Cytokine receptors [BR:cjc04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100388927 (TNFRSF13C)
CD molecules [BR:cjc04090]
 Proteins
  100388927 (TNFRSF13C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BaffR-Tall_bind TACI-CRD2 DUF4079 DUF4381 SKG6
Motif
Other DBs
NCBI-GeneID: 100388927
NCBI-ProteinID: XP_008989110
Ensembl: ENSCJAG00000002372
UniProt: U3DPW7
Position
Un
AA seq 185 aa AA seqDB search
MRRGPRSLRGRDAPVPTPCVPTECYDLLVRKCVDCRLLRRSPPKTAAGASSPAPGTALQP
QESVGPGAGEVSLPVPRLLFGAPALLGLVLVLALVLVGLVSWRRRQQRLRGAASSEAPDD
GDEAAPEPLDKLIILSPGTTDATASAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKT
AGPEQ
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgaggaccccggagcctgcgaggcagggacgcgccggtccccacgccctgcgtc
ccgaccgagtgctacgacctgctggtccgtaaatgcgtggactgtaggctcctacgcaga
tcgccaccgaaaacagcagctggagccagcagccctgcacccgggacggcgctgcagcct
caggagtcggtgggcccgggggccggcgaggtgtcgctgcccgtgcccagactgctcttc
ggcgcccccgcgctcctgggcctggtactggtcctggcgctggtcctggtgggcctggtg
agctggaggcggcgacagcagcggcttcgcggggcagcctcgtctgaggccccggacgac
ggagacgaggccgccccagagcccctggacaagctcatcattttgtctccaggaaccact
gatgccacagcttctgcctggcctcctcctggagaagacccaggaaccaccccacctggc
cacagcgtccctgtgccagccacagagctgggctccactgaactggtgaccaccaagaca
gctggccctgagcaataa

DBGET integrated database retrieval system