KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100388952Help
Entry
100388952         CDS       T03264                                 

Gene name
IFNG, IFN-gamma, interferon
Definition
(RefSeq) interferon gamma
  KO
K04687  interferon gamma
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03050  Proteasome
cjc04060  Cytokine-cytokine receptor interaction
cjc04066  HIF-1 signaling pathway
cjc04217  Necroptosis
cjc04350  TGF-beta signaling pathway
cjc04380  Osteoclast differentiation
cjc04612  Antigen processing and presentation
cjc04630  Jak-STAT signaling pathway
cjc04650  Natural killer cell mediated cytotoxicity
cjc04657  IL-17 signaling pathway
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04660  T cell receptor signaling pathway
cjc04940  Type I diabetes mellitus
cjc05132  Salmonella infection
cjc05140  Leishmaniasis
cjc05142  Chagas disease (American trypanosomiasis)
cjc05143  African trypanosomiasis
cjc05144  Malaria
cjc05145  Toxoplasmosis
cjc05146  Amoebiasis
cjc05152  Tuberculosis
cjc05160  Hepatitis C
cjc05164  Influenza A
cjc05168  Herpes simplex virus 1 infection
cjc05200  Pathways in cancer
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cjc05321  Inflammatory bowel disease (IBD)
cjc05322  Systemic lupus erythematosus
cjc05323  Rheumatoid arthritis
cjc05330  Allograft rejection
cjc05332  Graft-versus-host disease
cjc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    100388952 (IFNG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100388952 (IFNG)
   04630 Jak-STAT signaling pathway
    100388952 (IFNG)
   04066 HIF-1 signaling pathway
    100388952 (IFNG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100388952 (IFNG)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100388952 (IFNG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100388952 (IFNG)
   04612 Antigen processing and presentation
    100388952 (IFNG)
   04660 T cell receptor signaling pathway
    100388952 (IFNG)
   04658 Th1 and Th2 cell differentiation
    100388952 (IFNG)
   04659 Th17 cell differentiation
    100388952 (IFNG)
   04657 IL-17 signaling pathway
    100388952 (IFNG)
  09158 Development
   04380 Osteoclast differentiation
    100388952 (IFNG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100388952 (IFNG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100388952 (IFNG)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    100388952 (IFNG)
   05323 Rheumatoid arthritis
    100388952 (IFNG)
   05321 Inflammatory bowel disease (IBD)
    100388952 (IFNG)
   05330 Allograft rejection
    100388952 (IFNG)
   05332 Graft-versus-host disease
    100388952 (IFNG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100388952 (IFNG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100388952 (IFNG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100388952 (IFNG)
   05152 Tuberculosis
    100388952 (IFNG)
  09172 Infectious disease: viral
   05164 Influenza A
    100388952 (IFNG)
   05160 Hepatitis C
    100388952 (IFNG)
   05168 Herpes simplex virus 1 infection
    100388952 (IFNG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100388952 (IFNG)
   05144 Malaria
    100388952 (IFNG)
   05145 Toxoplasmosis
    100388952 (IFNG)
   05140 Leishmaniasis
    100388952 (IFNG)
   05142 Chagas disease (American trypanosomiasis)
    100388952 (IFNG)
   05143 African trypanosomiasis
    100388952 (IFNG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:cjc03051]
    100388952 (IFNG)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100388952 (IFNG)
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100388952 (IFNG)
Proteasome [BR:cjc03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    100388952 (IFNG)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interferons
   100388952 (IFNG)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate/Haparin
  Cytokines
   100388952 (IFNG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IFN-gamma API5 DUF5390 Tup_N
Motif
Other DBs
NCBI-GeneID: 100388952
NCBI-ProteinID: NP_001244155
Ensembl: ENSCJAG00000007181
UniProt: B9VS86
Position
9
AA seq 166 aa AA seqDB search
MKYTSYILAFQLCVVLGSLGCYCQDPYVKEAENLKKYFNAGDSDVADNGTLFLDILRTWR
EEGDRKIMQSQIISFYFKLFKNFKDNQSIQKSMETIKEDMNVKFFNSNKRKQDDFERLTN
YSVNDLNVQRKAIHELIQVMAELSPAPKIGKRKRSQTLFRGRRASQ
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatacaagttatatcttggcttttcagctctgcgtcgttttgggttctcttggc
tgttactgccaggacccatatgtaaaagaagcagaaaacctgaagaaatattttaatgca
ggtgattcagatgtagcagataatggaactcttttcttagacattttgaggacttggaga
gaggagggtgacagaaaaataatgcagagccagattatctccttttacttcaaacttttt
aaaaactttaaagacaaccagagcatccaaaagagtatggagaccatcaaggaagacatg
aatgtcaagtttttcaatagcaacaaaaggaaacaggatgactttgaaaggctgactaat
tattcggtaaacgacttgaatgtccagcgcaaagcaatacatgaactcatccaagtgatg
gctgaactgtcaccagcacctaaaatagggaagcgaaaaaggagtcagacgctgtttcga
ggtcgaagagcgtcccaataa

DBGET integrated database retrieval system