KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100389341Help
Entry
100389341         CDS       T03264                                 

Gene name
ITGAM
Definition
(RefSeq) integrin subunit alpha M
  KO
K06461  integrin alpha M
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04015  Rap1 signaling pathway
cjc04145  Phagosome
cjc04514  Cell adhesion molecules (CAMs)
cjc04610  Complement and coagulation cascades
cjc04640  Hematopoietic cell lineage
cjc04670  Leukocyte transendothelial migration
cjc04810  Regulation of actin cytoskeleton
cjc05133  Pertussis
cjc05134  Legionellosis
cjc05140  Leishmaniasis
cjc05146  Amoebiasis
cjc05150  Staphylococcus aureus infection
cjc05152  Tuberculosis
cjc05202  Transcriptional misregulation in cancer
cjc05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100389341 (ITGAM)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    100389341 (ITGAM)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100389341 (ITGAM)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100389341 (ITGAM)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100389341 (ITGAM)
   04610 Complement and coagulation cascades
    100389341 (ITGAM)
   04670 Leukocyte transendothelial migration
    100389341 (ITGAM)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100389341 (ITGAM)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100389341 (ITGAM)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100389341 (ITGAM)
   05134 Legionellosis
    100389341 (ITGAM)
   05150 Staphylococcus aureus infection
    100389341 (ITGAM)
   05152 Tuberculosis
    100389341 (ITGAM)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100389341 (ITGAM)
   05140 Leishmaniasis
    100389341 (ITGAM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100389341 (ITGAM)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100389341 (ITGAM)
   04515 Cell adhesion molecules [BR:cjc04515]
    100389341 (ITGAM)
   04090 CD molecules [BR:cjc04090]
    100389341 (ITGAM)
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100389341 (ITGAM)
Membrane trafficking [BR:cjc04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    100389341 (ITGAM)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100389341 (ITGAM)
Cell adhesion molecules [BR:cjc04515]
 Integrins
  Integrin alpha subunits
   100389341 (ITGAM)
CD molecules [BR:cjc04090]
 Proteins
  100389341 (ITGAM)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate/Haparin
  Adhesion molecules of cell surface
   100389341 (ITGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 Integrin_alpha VCBS FG-GAP_2 DUF11
Motif
Other DBs
NCBI-GeneID: 100389341
NCBI-ProteinID: XP_017834371
Ensembl: ENSCJAG00000003220
Position
12
AA seq 1153 aa AA seqDB search
MARRVLLLTALALCHGFNLDTENAMTFQENAAGFGQTVVQLPGSRVVVGAPQQAVAANQT
GSLYQCDYGIGSCEPIRLQVPPDAVNMSLGLSLAATASAPQLLVTCGPTVHQTCXENTYV
KGSASCLDPTLRQQPQRFPETSEGCPQQDSDIAFLIDGSGSINPNDFRRMKEFVSTVMEQ
LKKSKTLFSLMQYSNEFWTHFTFKEFQDNPNPRSLVRPITQLSGWTYTATGIRKVVRELF
NVRQGARENALKILVVITDGEKFRDPLTYEDVIPEADREGVIRYVIGVGDAFSSEKSRQE
LNTIASKPPRDHVFRVNNFEALKTIQNQLQEKIFAIEGTQSGSTSSFEHEMSQEGFSAAI
TSNGPLLSTVGSYDWAGGAFLYTSKEKSTFINMTRVDSDMNDAYLGYAAAVIFRNRVQTL
VLGAPRYQHVGLVAMFRQNAGMWESNANVKGTQIGAYFGGSLCSVDVDSNGSTDLVLVGA
PHYYEQTRGGQVSVCPLPKGQRARWQCDAVLHGEQGHPWGRFGAALTVLGDVNGDKLTDV
AIGAPGEEDNRGAVYLFHGTSGFGINPSHSQRIAGSKLSPRLQYFGQSLSGGQDLTMDGL
VDLTVGAQGHVLLLRSQPVLRVEATMEFNPREVARNAFECNDPAAEGKEAGEVRVCLHVH
KSTRDRLREGQIQSVVTYDLALDSSRKNSRAIFDETKNSTRRQTQTLGLTQTCKTLKLQL
LNCIEDIVSPVMLRLNFSLVGTPLSAFGNLRPVLAAEARRVFTASFPFEKNCGNDSICQD
DLSITFSFMGLDYLVVGGPREFNVTVTVRNDGEDSYRTQATFFFPPGLSYRVSRSQNQRS
QRPWRLDCELPSSTEVSGPLKSTSCSINHPIFPENSEVTFNITFDVDTKASLGNKLLLKA
NVTSENNMSRTNKTEFQLELPVKYAVYMVVTSHEVSTKYLNFTASENTSRVMQHQYQVSN
LGQRTLPISLVFLVPVRLNQAIIWDHPQVTFSENLSSTCHTKESLPPHSDFVAELRKAPV
VNCSIAVCQRIQCDIPFFGIQEEFNATLKGNLSFDWYIKTSHNHLLVVSTAEILFNNSVF
TLLPGQEAFVRAQTETKVEPFEVPNPVPLIVGSSVGGLVLLALITAALYKLGFFKRQYKD
MMSEGGPPGAAPQ
NT seq 3462 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcagagtccttctgttaacagccttggccttatgtcatgggttcaacctggac
actgaaaacgcaatgaccttccaagagaatgcagcgggctttgggcagaccgtggtccag
cttccgggatccagggtggtggtcggagccccccagcaggcagtggctgcaaaccagacg
ggcagcctctaccagtgcgactacggcattggctcctgcgagcccatccgcctgcaggtc
cccccagatgccgtgaatatgtccttgggtctgtccctggcagccaccgccagcgccccc
cagctgctggtgacctgcggtcccaccgtgcaccagacttgcnaggagaacacgtatgtg
aaaggttctgcttcctgtttggatccaaccctacggcagcagccccagaggttcccagaa
acctccgaaggatgccctcaacaggatagtgacattgccttcttaattgatggctctggt
agcatcaacccaaatgactttcggcggatgaaggagtttgtctcaaccgtgatggagcaa
ttaaaaaagtctaaaaccttgttctctttgatgcagtactccaatgaattctggactcac
ttcaccttcaaagagtttcaggacaaccctaacccaagatcgctggtgaggccaataacg
cagctgtctgggtggacatacacggccaccggcatccgcaaagtggtacgagaactgttt
aacgtccgccaaggagcccgagagaatgcccttaagatcctagttgtcatcacagatgga
gaaaagtttcgtgatcccttgacatatgaggatgtcatccccgaggcagacagagaggga
gtcattcgctacgtcattggggtgggagatgccttcagcagtgagaaatcccgccaagag
cttaataccattgcatccaagccgcctcgcgatcatgtgttccgggtgaataacttcgag
gctctgaagaccattcagaatcagctccaggagaagatctttgcgatcgagggtactcag
tcaggaagtaccagctcctttgagcacgagatgtctcaggaagggttcagtgctgccatc
acctctaacggccccttgctgagcactgtggggagctatgactgggctggtggagccttt
ctgtatacatcaaaagagaaaagcaccttcatcaacatgaccagagtggattcagacatg
aatgatgcttacttgggttatgctgccgctgtcatctttcggaaccgggttcaaaccctg
gttctgggggcacctcggtatcagcatgtcggcctggtggcgatgttcaggcagaacgct
ggcatgtgggagtccaacgctaatgtcaagggcacccagattggcgcctacttcgggggt
tccctctgctctgtggacgtggacagcaacggcagcactgacctggtccttgtcggggcc
ccccattactacgagcagacccgagggggccaagtgtccgtgtgccccttgcccaagggg
cagagggctcggtggcagtgtgacgctgttctccacggggagcagggccacccctggggc
cgctttggggcagccctgacagtgctgggggatgtgaatggggacaagctgacggatgtg
gccattggggccccaggagaggaggacaaccggggtgctgtttacctgtttcatggaacc
tcaggatttggcatcaacccctcacatagccagcggattgcaggctccaagctctctccg
aggctccagtattttggtcagtcactgagtgggggccaggacctcacaatggatggactc
gtggacctgactgtgggagcgcaggggcacgtgctgctactcaggtcccagccagtactg
agagttgaggcgaccatggagttcaatcccagggaagtggcaaggaatgcatttgagtgt
aatgatccagcagcagaaggcaaggaagctggggaggtcagagtctgcctccatgtccac
aagagcacacgggatcggctaagagaagggcagatccagagtgttgtgacttatgatctg
gctctggactccagccgaaaaaattcccgagccatcttcgatgagacaaagaacagcaca
cgcagacagacacagaccttagggctgacccagacttgtaagactctgaagctacagttg
ctgaattgcatcgaggacatagtgagccccgtcatgctgcgcttgaacttctctctggtg
gggacgcccttgtctgcctttgggaaccttcggccagtgctagctgcggaggctcggaga
gtcttcacagcctcgtttccctttgagaagaattgtggcaatgacagcatctgccaggac
gacctcagcatcaccttcagtttcatgggcctggactacctcgtggtgggtggcccccgg
gagttcaacgtgacagtgactgtgagaaatgacggcgaggactcctacaggacgcaggcc
accttcttcttcccgcctggcctgtcctaccgggtgtccagatcccagaaccagcgctca
cagcgaccctggcgcctggactgtgagttgccttcctccaccgaagtgtctggacccttg
aagagcaccagctgcagcataaaccaccccatcttcccggaaaactcagaggtcaccttc
aatatcacgtttgatgtggacactaaggcttcccttggaaacaagctgctcctcaaggcc
aacgtgaccagtgagaacaacatgtccagaaccaacaaaactgaattccagctggagctg
ccagtgaaatatgctgtctacatggtggtcaccagccatgaggtctccaccaaatatctc
aacttcacagcctcagagaataccagtcgagtcatgcagcatcaatatcaggtcagcaac
ctggggcaaaggaccctccccatcagcctggtgttcttggtgcccgtccggctgaaccag
gcgatcatatgggaccacccccaggtcaccttctccgagaacctctcgagtacgtgccac
accaaggagagcttgccccctcactccgactttgtggctgagcttcggaaggcccccgtg
gtgaactgctccatcgctgtctgccagagaatccagtgtgacatcccgttctttggcatc
caggaagaattcaacgccaccctcaaaggcaacctctcatttgattggtacatcaagacc
tcgcataaccacctcctggttgtgagcacagctgagatcttgtttaacaattccgtgttc
accctgctgccgggacaggaggcgtttgtgagggcccagacggagaccaaagtggaacct
ttcgaggtccccaacccggtgccgctcatcgtgggcagctctgtgggggggctggtgctc
ctggccctcatcactgctgcgctgtacaagctcggcttcttcaagcggcagtacaaggac
atgatgagtgaagggggtcccccgggggccgcaccccagtag

DBGET integrated database retrieval system