KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100389395Help
Entry
100389395         CDS       T03264                                 

Gene name
AGT, ANGT, SERPINA8
Definition
(RefSeq) angiotensinogen
  KO
K09821  angiotensinogen
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04072  Phospholipase D signaling pathway
cjc04080  Neuroactive ligand-receptor interaction
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04270  Vascular smooth muscle contraction
cjc04614  Renin-angiotensin system
cjc04924  Renin secretion
cjc04925  Aldosterone synthesis and secretion
cjc04927  Cortisol synthesis and secretion
cjc04931  Insulin resistance
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc04934  Cushing syndrome
cjc05200  Pathways in cancer
cjc05410  Hypertrophic cardiomyopathy (HCM)
cjc05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    100389395 (AGT)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100389395 (AGT)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    100389395 (AGT)
   04614 Renin-angiotensin system
    100389395 (AGT)
   04925 Aldosterone synthesis and secretion
    100389395 (AGT)
   04927 Cortisol synthesis and secretion
    100389395 (AGT)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100389395 (AGT)
   04270 Vascular smooth muscle contraction
    100389395 (AGT)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100389395 (AGT)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    100389395 (AGT)
   05414 Dilated cardiomyopathy (DCM)
    100389395 (AGT)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100389395 (AGT)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100389395 (AGT)
   04934 Cushing syndrome
    100389395 (AGT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Serpin FIST
Motif
Other DBs
NCBI-GeneID: 100389395
NCBI-ProteinID: NP_001171966
Ensembl: ENSCJAG00000011972
UniProt: Q9TSZ0
Position
19
AA seq 486 aa AA seqDB search
MQKRVPQSEMPPASMSLRVTILCLLAWAGLAAGDRVYIHPFHLVIHNESTCEELAKANAG
KPEDPTFTPALIQAKSLPVDEKALQDQLVLVAAKLNAEDKLRAATVGMLANFLSFHIYSM
HSELWGMVQGATILSPMAVFGTLASLYLGASNHTAYRLQAILGVPWKDENCTSRLDAHKV
LSALQAVQGLLVAQDRAEGQTQLLLSTVVGLFTAPGLHLKQPFVQGLALYAPAVLPRSLD
FSTDLDVAAEKIDRFMQAVTGWKVSSPLTGASADSNLVFNTYVHFQGKMKGFSLLAEPQE
FWVDNSTSVSVPMLSGMGTFQHWSDAQDKFSVTQVPFTESACLLLIQPHYASDLDKVEGL
TFQQNSLNWMNKLSPRAIHLTMPRLVLRGSYDLQDLLAQAELPTILGTELNLQKMSNNNL
RVGKVLNSIFFELEADEKEPTESTQQPKGPEVLELNLNHPFLFAVYDQDATALYFLGRVA
NPLTTV
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagcgagtgccccagtctgagatgcctcctgccagcatgagcctgagggtcacc
atcctctgcctcctggcctgggctggcctggccgcaggtgaccgggtgtacatacacccc
ttccacctcgtcatccacaatgagagtacctgtgaggagctggcgaaggccaatgcaggg
aagcccgaagatcccaccttcacacctgctctgatccaggccaagtcgctccctgtggat
gagaaggccctgcaggaccagcttgtgcttgttgctgcaaaactcaacgctgaagacaag
ttgagggctgcgacggtcgggatgctggccaacttcctgagcttccacatatacagcatg
cacagtgagctgtggggcatggtccaaggggccaccatcctctccccgatggctgtcttt
ggcactctggcctctctctacctgggagcctccaaccacacagcctacaggctacaagca
atcctgggtgtcccttggaaggacgagaattgcacttcccggctggatgcacacaaggtc
ctctctgccctgcaggccgtccagggcctgctggtggcccaggacagggctgagggccag
acccagctgctgctgtccacagtggtgggcctcttcacggccccaggcctgcacctgaag
cagccatttgtgcagggcctggctctctatgcccccgcggtcctcccacgctctctggac
ttctccacagacctggatgtcgctgccgagaagatcgacaggttcatgcaggcggtgaca
gggtggaaggtcagcagccccctgacgggagccagtgcggacagcaacctggttttcaac
acctacgtccacttccaagggaagatgaagggcttctccctgctggccgagccccaggag
ttctgggtggacaacagcacctcagtgtctgtccccatgctctctggcatgggcaccttc
cagcactggagcgatgcccaggacaaattctcagtgactcaagtgcccttcactgagagc
gcctgcctgctgctgatccagcctcactatgcctctgacctggacaaggtggagggcctc
accttccagcagaactccctcaactggatgaataaactgtctccccgggccatccacctg
accatgccccggctggtgctgcgaggatcttatgacctgcaggacctgctcgcccaggct
gagctgcccaccattctgggcactgagctgaacctgcaaaaaatgagcaacaacaacctc
agggtgggaaaggtgctgaacagcattttttttgaactcgaagcggatgagaaagagccc
acagagtctacccaacagcctaaggggcctgaggtcttggagttgaacctgaaccaccca
ttcctgtttgctgtgtatgatcaagatgccactgccctgtacttcctgggccgtgtggcc
aaccctctgaccacagtgtga

DBGET integrated database retrieval system