KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100389403Help
Entry
100389403         CDS       T03264                                 

Gene name
KCNJ6
Definition
(RefSeq) potassium voltage-gated channel subfamily J member 6
  KO
K05000  potassium inwardly-rectifying channel subfamily J member 6
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04713  Circadian entrainment
cjc04723  Retrograde endocannabinoid signaling
cjc04725  Cholinergic synapse
cjc04726  Serotonergic synapse
cjc04727  GABAergic synapse
cjc04728  Dopaminergic synapse
cjc04915  Estrogen signaling pathway
cjc04921  Oxytocin signaling pathway
cjc05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100389403 (KCNJ6)
   04921 Oxytocin signaling pathway
    100389403 (KCNJ6)
  09156 Nervous system
   04727 GABAergic synapse
    100389403 (KCNJ6)
   04725 Cholinergic synapse
    100389403 (KCNJ6)
   04728 Dopaminergic synapse
    100389403 (KCNJ6)
   04726 Serotonergic synapse
    100389403 (KCNJ6)
   04723 Retrograde endocannabinoid signaling
    100389403 (KCNJ6)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100389403 (KCNJ6)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100389403 (KCNJ6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cjc04040]
    100389403 (KCNJ6)
Ion channels [BR:cjc04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   100389403 (KCNJ6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRK_C IRK Ion_trans_2
Motif
Other DBs
NCBI-GeneID: 100389403
NCBI-ProteinID: XP_002761460
Ensembl: ENSCJAG00000002599
Position
21
AA seq 442 aa AA seqDB search
MAKLTESMTNVLEGDSMDQDVESPVAIHQPKLPKQARDDLPRHISRDRTKRKIQRYVRKD
GKCNVHHGNVRETYRYLTDIFTTLVDLKWRFNLLIFVMVYTVTWLFFGMIWWLIAYIRGD
MDHIEDPSWTPCVTNLNGFVSAFLFSIETETTIGYGYRVITDKCPEGIILLLIQSVLGSI
VNAFMVGCMFVKISQPKKRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIRAK
LIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKE
ELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVDYNSFHETYET
STPSLSAKELAELASRAELPLSWSVSSKLNQHAELETEEEEKNLEEQTERNECESRAIQE
TQTSFPNSPGEPVGFQVWVFRA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctgacagaatccatgactaacgtcctggagggcgactccatggatcaggac
gtcgagagcccagtggccattcaccagccaaagttgcctaagcaggccagggatgacctg
ccaagacacatcagccgagaccggaccaaaaggaaaatccagaggtacgtgaggaaagac
ggaaagtgcaacgttcatcacggcaacgtgagggagacctatcgctacctgaccgatatc
ttcaccaccttagttgacctgaagtggagattcaacctgttgattttcgtcatggtttac
acagtgacctggctcttttttggaatgatctggtggttgattgcgtacatccggggagat
atggaccacatagaggacccctcatggactccttgtgttaccaacctcaacgggtttgtc
tctgcttttttattctcaatagagacagaaaccaccattggttatggctaccgggtcatc
acggataaatgcccggagggaattattctcctcttaatccagtctgtgctggggtccatt
gtcaatgcattcatggtgggatgcatgtttgtaaagatctcccaacccaagaagagggca
gagaccctggtcttttccacccatgcagtgatctctatgcgggatgggaagctgtgcctg
atgttccgggtaggggaccttaggaattcccacattgtggaggcttccatcagagccaag
ttgatcaaatccaaacagacctcggagggggagttcatcccgttgaaccagacagatatc
aacgtagggtattacacaggggatgaccgtctgtttctggtgtcaccactgatcattagc
cacgaaattaaccaacagagtcctttctgggagatctccaaagcccagctgccgaaagag
gaactggaaattgtggtcatcctggaaggaatggtggaagccacagggatgacgtgccag
gctcgaagctcctacatcaccagtgagatcctgtggggttaccgcttcacacctgtcctg
acactggaggatgggttctacgaagttgactacaacagcttccatgagacctatgagacc
agcaccccatcccttagtgccaaagagctggccgagttagccagcagggcggagctgccc
ctgagttggtctgtatccagcaaactcaaccagcatgcagaactggagacggaagaggaa
gaaaagaacctcgaagagcaaacggaaagaaatgaatgtgaatccagagccatccaggaa
actcagacatccttccctaactcccccggggagccagtaggtttccaagtatgggtcttc
agagcttga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100401709Help
Entry
100401709         CDS       T03264                                 

Gene name
KCNJ9
Definition
(RefSeq) potassium voltage-gated channel subfamily J member 9
  KO
K05002  potassium inwardly-rectifying channel subfamily J member 9
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04713  Circadian entrainment
cjc04723  Retrograde endocannabinoid signaling
cjc04726  Serotonergic synapse
cjc04728  Dopaminergic synapse
cjc04915  Estrogen signaling pathway
cjc04921  Oxytocin signaling pathway
cjc05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100401709 (KCNJ9)
   04921 Oxytocin signaling pathway
    100401709 (KCNJ9)
  09156 Nervous system
   04728 Dopaminergic synapse
    100401709 (KCNJ9)
   04726 Serotonergic synapse
    100401709 (KCNJ9)
   04723 Retrograde endocannabinoid signaling
    100401709 (KCNJ9)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100401709 (KCNJ9)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100401709 (KCNJ9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cjc04040]
    100401709 (KCNJ9)
Ion channels [BR:cjc04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   100401709 (KCNJ9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRK_C IRK Ion_trans_2
Motif
Other DBs
NCBI-GeneID: 100401709
NCBI-ProteinID: XP_017821650
Position
18
AA seq 393 aa AA seqDB search
MAQENAAFSPGPEEPPRRRGRQRYVEKDGRCNVQQGNVRETYRYLTDLFTTLVDLQWRLS
LLFFVLAYALTWLFFGAIWWLIAYGRGDLEHLEDTAWTPCVNNLNGFVAAFLFSIETETT
IGYGHRVITDQCPEGIVLLLLQAILGSMVNAFMVGCMFVKISQPNKRAATLVFSSHAVVS
LRDGRLCLMFRVGDLRSSHIVEASIRAKLIRSRQTLEGEFIPLHQTDLSVGFDTGDDRLF
LVSPLVISHEIDAASPFWEASRRALERDDFEIVVILEGMVEATGMTCQARSSYLVDEVLW
GHRFTSVLTLEDGFYEVDYASFXRDLEVPTPSCSARELAEAAARLDAHLYWSIPSRLYDK
VEEEGAGDGVHGHCILEVEEERRVVEAKPLEMC
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaggagaacgcggccttctcgcccgggccggaggagccgccgcggcgccgcggc
cgccagcgctacgtggagaaggacggccggtgcaacgtgcagcagggcaacgtgcgcgag
acgtaccgctacctgaccgacctgttcaccacgctggtggacctgcagtggcgcctcagc
ctgctgttcttcgtgctggcctacgcgctcacctggctcttcttcggcgccatctggtgg
ctgatcgcctacggccgcggcgacctggagcacctggaggacaccgcgtggacgccgtgc
gtcaacaacctcaacggcttcgtggccgccttcctcttctccatcgagacggagaccacc
atcggctacgggcaccgcgtcatcaccgaccagtgccccgagggcatcgtgctgctgctg
ctccaggccatcctgggctccatggtgaacgccttcatggtgggctgcatgttcgtcaag
atctcgcagcccaacaagcgcgccgccacgctcgtcttctcctcgcacgccgtggtgtcg
ttgcgcgacgggcgcctctgcctcatgttccgcgtgggcgacctgcgctcctcgcatatc
gtggaggcctccatccgcgccaagctcatccgctcgcgccagacgctggagggcgagttc
atcccgctgcaccagaccgacctcagcgtgggcttcgacacgggcgacgaccgcctcttc
ctcgtctcgccgctcgtcatcagccacgagatcgatgccgccagccccttctgggaggcg
tcgcgccgcgccctcgagagggacgacttcgagatcgttgtcatcctcgagggcatggtg
gaagccacgggaatgacatgccaagctcggagctcctacctggtagacgaggtgctgtgg
ggccaccgcttcacgtcagtgttgaccctggaggacggcttctatgaggtggactatgcc
agcttcnnacgagaccttgaggtgcccacaccttcgtgcagtgctcgagagctggcagag
gctgccgcccgccttgatgcccatctctactggtccatccccagccgcctgtatgataag
gtggaggaggaaggggcgggggatggggtacatgggcactgcatcttggaggtggaggag
gagcgacgcgttgtggaggcaaagcccctggaaatgtgctaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100410336Help
Entry
100410336         CDS       T03264                                 

Gene name
KCNJ3
Definition
(RefSeq) potassium voltage-gated channel subfamily J member 3
  KO
K04997  potassium inwardly-rectifying channel subfamily J member 3
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04713  Circadian entrainment
cjc04723  Retrograde endocannabinoid signaling
cjc04724  Glutamatergic synapse
cjc04725  Cholinergic synapse
cjc04726  Serotonergic synapse
cjc04728  Dopaminergic synapse
cjc04915  Estrogen signaling pathway
cjc04921  Oxytocin signaling pathway
cjc05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100410336 (KCNJ3)
   04921 Oxytocin signaling pathway
    100410336 (KCNJ3)
  09156 Nervous system
   04724 Glutamatergic synapse
    100410336 (KCNJ3)
   04725 Cholinergic synapse
    100410336 (KCNJ3)
   04728 Dopaminergic synapse
    100410336 (KCNJ3)
   04726 Serotonergic synapse
    100410336 (KCNJ3)
   04723 Retrograde endocannabinoid signaling
    100410336 (KCNJ3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100410336 (KCNJ3)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100410336 (KCNJ3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cjc04040]
    100410336 (KCNJ3)
Ion channels [BR:cjc04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   100410336 (KCNJ3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRK_C IRK
Motif
Other DBs
NCBI-GeneID: 100410336
NCBI-ProteinID: XP_002749477
Ensembl: ENSCJAG00000015490
UniProt: F7AN67
Position
6
AA seq 501 aa AA seqDB search
MSALRRKFGDDYQVVTTSSSGSGLQPQGPGQDPQQQLVPKKKRQRFVDKNGRCNVQHGNL
GSETSRYLSDLFTTLVDLKWRWNLFIFILTYTVAWLFMASMWWVIAYTRGDLNKAHVGNY
TPCVANVYNFPSAFLFFIETEATIGYGYRYITDKCPEGIILFLFQSILGSIVDAFLIGCM
FIKMSQPKKRAETLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKSRQTPE
GEFLPLDQLELDVGFSTGADQLFLVSPLTICHVIDAKSPFYDLSQRSMQTEQFEIVVILE
GIVETTGMTCQARTSYTEDEVLWGHRFFPVISLEEGFFKVDYSQFHATFEVPTPPYSVKE
QEEMLLMSSPLIAPAITNSKERHNSVECLDGLDDITTKLPSKLQKITGREDFPKKLLRMS
STTSEKAYSLGDLPMKLQRISSVPGNSEEKLVSKTTKMLSDPMSQSVADLPPKLQKMAGG
AARMEGNLPAKLRKMNSDRFT
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcactccgaaggaaatttggggacgattaccaggtagtgaccacatcgtccagc
ggctcgggcttgcagccccaggggccaggccaggacccgcagcagcagcttgtgcccaag
aagaagcggcagcggttcgtggacaagaacggccggtgcaatgtacagcacggcaacctg
gggagcgagacgagccgctacctctcggacctcttcaccacgctggtggacctcaagtgg
cgctggaacctcttcatcttcattctcacctacaccgtggcctggctcttcatggcgtcc
atgtggtgggtgatcgcctacactcggggcgacctgaacaaagcccatgtcggtaactac
acgccttgcgtggccaatgtctataacttcccttctgccttcctcttcttcatcgagacc
gaggccaccatcggctatggctaccgatacatcaccgacaagtgccccgagggcatcatc
ctcttcctcttccagtccatcctgggctccatcgtggacgccttcctcatcggctgcatg
ttcatcaagatgtcccagcccaagaagcgcgccgagaccctcatgttcagcgagcacgcg
gtgatctccatgagggacggaaaactcacgcttatgttccgggtgggcaacctgcgcaac
agccacatggtctccgcgcagatccgctgcaagctgctcaaatctcggcagacacctgag
ggtgagttccttccccttgaccaacttgaactggatgtaggttttagtacaggggcagat
caactttttcttgtgtccccactcacaatttgccacgtgatcgatgccaaaagccccttt
tatgacctatcccagcgaagcatgcaaactgaacagttcgagattgtcgtcatcctagaa
ggcattgtggaaacaactgggatgacttgtcaagctcgaacatcatatactgaagatgaa
gttctttggggtcatcgtttttttcctgtaatttccttagaagagggattctttaaagtt
gattactctcagttccatgcaacatttgaagtccccaccccaccttacagtgtgaaagag
caggaggaaatgcttctcatgtcgtcccctttaatagcaccagccataactaatagcaaa
gaaagacataattctgtggaatgcttagatggactagatgacattactacaaaactacca
tctaagctgcagaaaattactggaagagaagactttcccaaaaaactcttgaggatgagt
tctacaacttcagaaaaagcctacagcttgggagacttgcccatgaaacttcaacgaata
agttcagttccaggcaactcagaagaaaaactggtatctaaaaccaccaagatgttatca
gatcccatgagccagtctgtggctgatttgccaccaaagcttcaaaagatggctggagga
gcagctaggatggaagggaatcttccagccaaattaagaaaaatgaactctgatcgcttc
acataa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100412518Help
Entry
100412518         CDS       T03264                                 

Gene name
KCNJ5
Definition
(RefSeq) potassium voltage-gated channel subfamily J member 5
  KO
K04999  potassium inwardly-rectifying channel subfamily J member 5
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04713  Circadian entrainment
cjc04723  Retrograde endocannabinoid signaling
cjc04726  Serotonergic synapse
cjc04728  Dopaminergic synapse
cjc04915  Estrogen signaling pathway
cjc04921  Oxytocin signaling pathway
cjc04925  Aldosterone synthesis and secretion
cjc05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100412518 (KCNJ5)
   04921 Oxytocin signaling pathway
    100412518 (KCNJ5)
   04925 Aldosterone synthesis and secretion
    100412518 (KCNJ5)
  09156 Nervous system
   04728 Dopaminergic synapse
    100412518 (KCNJ5)
   04726 Serotonergic synapse
    100412518 (KCNJ5)
   04723 Retrograde endocannabinoid signaling
    100412518 (KCNJ5)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100412518 (KCNJ5)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100412518 (KCNJ5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cjc04040]
    100412518 (KCNJ5)
Ion channels [BR:cjc04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   100412518 (KCNJ5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRK_C IRK Ion_trans_2
Motif
Other DBs
NCBI-GeneID: 100412518
NCBI-ProteinID: XP_002754625
Position
11
AA seq 432 aa AA seqDB search
MAGDSRNAMNKGMEIGVTAWDPKKIPKQARDYVPIATDRTRLLAEGKKPRQRYMEKSGKC
NVHHGNVQETYRYLSDLFTTLVDLKWRFNLLVFTMVYTVTWLFFGFIWWLIAYIRGDLDH
VGDREWIPCVENLSGFVSAFLFSIETETTIGYGFRVITEKCPEGIILLLVQAILGSIVNA
FMVGCMFVKISQPKKRAETLMFSNNAVISMRDEKLCLMFRVGDLRNSHIVEASIRAKLIK
SRQTKEGEFIPLNQTDINVGFDTGDDRLFLVSPLIISHEINEKSPFWEMSQAQLHQEEFE
VVVILEGMVEATGMTCQARSSYMDTEVLWGHRFTPVLTLEKGFYEVDYNTFHDTYETNTP
SCCAKELAEMKREGRLLQYLPSPLLLGGCAEAGVDAEAEQNEEDEPKRQGFINLLMKKNT
TAALKIHPIKWP
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggctggcgattccaggaatgccatgaacaagggcatggagattggagttactgcctgg
gaccccaagaaaattcccaaacaggcccgcgattacgtccccattgccacagaccgcacg
cgcctgctggccgagggcaagaagccacgccagcgctacatggagaagagcggcaagtgc
aacgtgcaccacggcaacgtccaggagacctaccggtacctgagcgaccttttcactacc
ctggtggacctcaagtggcgcttcaacctgcttgtcttcaccatggtttacactgtcacc
tggctgttcttcggcttcatttggtggctcattgcttatatccggggtgacctggaccat
gttggcgaccgagagtggattccttgtgttgaaaacctcagtggcttcgtgtctgctttc
ctgttctccattgagaccgaaacgaccattgggtacggcttccgagtcatcacagagaag
tgtccagaggggatcatactcctgttggtccaggccatcctgggctccatcgtcaatgcc
ttcatggtggggtgcatgtttgtcaagatcagccagcccaagaagagagcggagaccctc
atgttttccaacaacgcggtcatttccatgcgggacgagaagctgtgcctcatgttccgg
gtgggcgacctccgcaactcccacatcgtagaggcctccatccgcgccaagctcatcaag
tcccggcagaccaaagagggggagttcatccccctgaaccagaccgacatcaacgtgggc
ttcgacacaggcgacgaccgcctcttcctggtgtctcccctcatcatctctcacgagatc
aatgagaagagccctttctgggagatgtctcaggctcagctgcatcaggaggagttcgaa
gtcgtggtcattctagaagggatggtggaagccacagggatgacctgccaagcccggagc
tcctacatggatacagaggtgctctggggccaccgattcacaccagtcctcaccttggaa
aagggcttctatgaggtggactacaacaccttccacgacacctatgagaccaacacaccc
agctgctgtgccaaggagctggccgaaatgaagcgggaaggccggctcctccagtacctc
cccagtcccctgctgttggggggctgtgctgaggcaggggtggatgcagaggctgagcag
aatgaggaagatgagcccaagaggcagggtttcatcaatcttcttatgaaaaagaacacc
actgcagcgctaaaaattcacccaataaaatggccttga

DBGET integrated database retrieval system