KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100389596Help
Entry
100389596         CDS       T03264                                 

Gene name
TGFBR1
Definition
(RefSeq) transforming growth factor beta receptor 1
  KO
K04674  TGF-beta receptor type-1 [EC:2.7.11.30]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04068  FoxO signaling pathway
cjc04144  Endocytosis
cjc04218  Cellular senescence
cjc04350  TGF-beta signaling pathway
cjc04371  Apelin signaling pathway
cjc04380  Osteoclast differentiation
cjc04390  Hippo signaling pathway
cjc04520  Adherens junction
cjc04659  Th17 cell differentiation
cjc04926  Relaxin signaling pathway
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc05142  Chagas disease (American trypanosomiasis)
cjc05161  Hepatitis B
cjc05166  Human T-cell leukemia virus 1 infection
cjc05200  Pathways in cancer
cjc05210  Colorectal cancer
cjc05212  Pancreatic cancer
cjc05220  Chronic myeloid leukemia
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Module
cjc_M00680  TGF-beta signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100389596 (TGFBR1)
   04350 TGF-beta signaling pathway
    100389596 (TGFBR1)
   04390 Hippo signaling pathway
    100389596 (TGFBR1)
   04371 Apelin signaling pathway
    100389596 (TGFBR1)
   04068 FoxO signaling pathway
    100389596 (TGFBR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100389596 (TGFBR1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100389596 (TGFBR1)
  09143 Cell growth and death
   04218 Cellular senescence
    100389596 (TGFBR1)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100389596 (TGFBR1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100389596 (TGFBR1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100389596 (TGFBR1)
  09158 Development
   04380 Osteoclast differentiation
    100389596 (TGFBR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100389596 (TGFBR1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100389596 (TGFBR1)
   05212 Pancreatic cancer
    100389596 (TGFBR1)
   05225 Hepatocellular carcinoma
    100389596 (TGFBR1)
   05226 Gastric cancer
    100389596 (TGFBR1)
   05220 Chronic myeloid leukemia
    100389596 (TGFBR1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100389596 (TGFBR1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100389596 (TGFBR1)
   05161 Hepatitis B
    100389596 (TGFBR1)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    100389596 (TGFBR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100389596 (TGFBR1)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     100389596 (TGFBR1)
Protein kinases [BR:cjc01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   100389596 (TGFBR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr TGF_beta_GS Activin_recp Pkinase_fungal APH Haspin_kinase FTA2
Motif
Other DBs
NCBI-GeneID: 100389596
NCBI-ProteinID: XP_002743193
Ensembl: ENSCJAG00000011244
Position
1
AA seq 503 aa AA seqDB search
MEAAAAAPRPRLLLLVLAAAAAAAALLLPGATALQCFCHLCTKDNFTCVTDGLCFVSVTE
TTDKVIHNTMCIAETDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKPSPG
LGPVELAAVIAGPVCFVCVSLMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDL
IYDMTTSGSGSGLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREER
SWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVE
GMIKLALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDS
ATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGGI
HEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGA
ARLTALRIKKTLSQLSQQEGIKM
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggaggcggcggccgctgctccgcgtccccgactgctcctccttgtgctggcggcggca
gcggcggcggcggcgctgctgctcccgggggcgacggcattacagtgtttctgccacctc
tgtacaaaagacaattttacttgtgtgacagatgggctctgctttgtctctgtcacggag
accacagacaaagttatacacaacaccatgtgtatagctgaaactgacttaattcctcga
gataggccatttgtatgtgcaccctcttcaaaaactgggtctgtgactacaacatattgc
tgcaatcaggaccattgcaataaaatagaacttccaactactgtgaagccatcacctggc
cttggtcccgtggaactggcagctgtcattgctggaccggtgtgcttcgtctgcgtctca
ctcatgttgatggtctatatctgccacaaccgcacagtcattcaccatcgagtgcctaat
gaagaggatccttcattagatcgcccttttatttcagagggtactacattgaaagactta
atttatgatatgacaacgtcaggttctggctcaggtttaccattgcttgttcagagaaca
attgcgagaactattgtgttacaagaaagcattggcaaaggtcgatttggagaagtttgg
agaggaaagtggaggggagaagaagttgctgttaagatattctcctctagagaagaacgt
tcatggttccgtgaggcagagatttatcaaactgtaatgttacgtcatgaaaatatcctg
ggatttatagcagcagacaataaagacaatggtacttggactcagctctggttggtgtca
gattatcatgagcatggatccctttttgattacttaaacagatacacagttactgtggaa
ggaatgataaaacttgctctgtccacagcaagtggtcttgcccatcttcacatggagatt
gttggtacccaaggaaagccagccattgctcatagggacttgaaatcgaagaatatcttg
gtaaagaagaatggaacttgctgtattgcagacttaggactggcagtaagacatgattca
gccacagatacaattgatattgctccaaaccacagagtgggaacaaaaaggtacatggcc
cctgaagttctcgatgattccataaatatgaaacattttgaatccttcaaacgtgccgac
atctatgcaatgggcttagtattctgggaaattgctcgacgatgttccattggtggtatt
catgaagattaccagctgccttattatgatcttgtaccttctgacccatcagttgaagaa
atgagaaaagtcgtttgtgaacagaagttaaggccaaatatcccaaacagatggcagagc
tgtgaagccctgagagtaatggctaaaattatgagagaatgttggtatgccaatggagca
gctaggcttaccgcattgcggattaagaaaacattatcacaactcagtcagcaggaaggc
atcaaaatgtaa

DBGET integrated database retrieval system