KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100389629Help
Entry
100389629         CDS       T03264                                 

Gene name
VEGFA, VEGF
Definition
(RefSeq) vascular endothelial growth factor A
  KO
K05448  vascular endothelial growth factor A
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc04010  MAPK signaling pathway
cjc04014  Ras signaling pathway
cjc04015  Rap1 signaling pathway
cjc04066  HIF-1 signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04370  VEGF signaling pathway
cjc04510  Focal adhesion
cjc04926  Relaxin signaling pathway
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc05163  Human cytomegalovirus infection
cjc05165  Human papillomavirus infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05206  MicroRNAs in cancer
cjc05211  Renal cell carcinoma
cjc05212  Pancreatic cancer
cjc05219  Bladder cancer
cjc05323  Rheumatoid arthritis
cjc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100389629 (VEGFA)
   04015 Rap1 signaling pathway
    100389629 (VEGFA)
   04010 MAPK signaling pathway
    100389629 (VEGFA)
   04370 VEGF signaling pathway
    100389629 (VEGFA)
   04066 HIF-1 signaling pathway
    100389629 (VEGFA)
   04151 PI3K-Akt signaling pathway
    100389629 (VEGFA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100389629 (VEGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100389629 (VEGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100389629 (VEGFA)
   05206 MicroRNAs in cancer
    100389629 (VEGFA)
   05205 Proteoglycans in cancer
    100389629 (VEGFA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100389629 (VEGFA)
   05211 Renal cell carcinoma
    100389629 (VEGFA)
   05219 Bladder cancer
    100389629 (VEGFA)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100389629 (VEGFA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100389629 (VEGFA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100389629 (VEGFA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100389629 (VEGFA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100389629 (VEGFA)
   05165 Human papillomavirus infection
    100389629 (VEGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100389629 (VEGFA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100389629 (VEGFA)
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100389629 (VEGFA)
Cytokines and growth factors [BR:cjc04052]
 Growth factors
  Growth factors (RTK binding)
   100389629 (VEGFA)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate/Haparin
  Growth factors/receptors
   100389629 (VEGFA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VEGF_C PDGF
Motif
Other DBs
NCBI-GeneID: 100389629
NCBI-ProteinID: XP_003732722
Ensembl: ENSCJAG00000012459
Position
4
AA seq 215 aa AA seqDB search
MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVD
IFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEEFNITMQIMRIKPHQGQHIGEM
SFLQHNKCECRPKKDRARQEKKSVPGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQ
DPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgaactttctgctctcttgggtgcattggagccttgccttgctgctctacctccaccat
gccaagtggtcccaggctgcacccatggcagaaggaggagggcagaatcaccacgaagtg
gtgaagttcatggatgtctaccagcgcagctactgccatccgatcgagaccctggtggac
atcttccaggagtaccctgatgagatcgagtacatcttcaagccatcctgtgtgcccctg
atgcgatgtgggggctgttgcaatgatgagggcctggagtgtgtgcccactgaggagttc
aacatcaccatgcagattatgcggatcaaacctcaccaaggccagcacataggagagatg
agcttcctacagcacaacaaatgtgaatgcagaccaaagaaagatagagcaagacaagaa
aaaaaatcagttccaggaaagggaaaggggcaaaaacgaaagcgcaagaaatcccggtat
aagtcctggagcgttccctgtgggccttgctcagagcggagaaagcatttgtttgtacaa
gatccacagacgtgtaaatgttcctgcaaaaacacagactcgcgttgcaaggcgaggcag
cttgagttaaacgaacgtacttgcagatgtgacaagccaaggcggtga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100395294Help
Entry
100395294         CDS       T03264                                 

Gene name
VEGFC
Definition
(RefSeq) vascular endothelial growth factor C
  KO
K05449  vascular endothelial growth factor C/D
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04014  Ras signaling pathway
cjc04015  Rap1 signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04510  Focal adhesion
cjc04926  Relaxin signaling pathway
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100395294 (VEGFC)
   04015 Rap1 signaling pathway
    100395294 (VEGFC)
   04010 MAPK signaling pathway
    100395294 (VEGFC)
   04151 PI3K-Akt signaling pathway
    100395294 (VEGFC)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100395294 (VEGFC)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100395294 (VEGFC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100395294 (VEGFC)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100395294 (VEGFC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100395294 (VEGFC)
Cytokines and growth factors [BR:cjc04052]
 Growth factors
  Growth factors (RTK binding)
   100395294 (VEGFC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDGF CXCXC
Motif
Other DBs
NCBI-GeneID: 100395294
NCBI-ProteinID: XP_002745243
Ensembl: ENSCJAG00000005434
UniProt: A0A2R8M3I1
Position
3
AA seq 420 aa AA seqDB search
MHLLGFSLACSLLAAALLPGPREAPAAAAAAAFESGLDYSDAEPDAGEATAYASKDLEEQ
LRSVSSVDELMTVLYPEYWKMYKCQLRKGGWQHSTEQANLSSRTEETIKFAAAHYNAEIL
KSIDNEWRKTQCMPREVCIDVGKESGAATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTG
YLSKTLFEITVPLSQGPKPITVSFANHTSCRCMSKLDVYRQVHSIIRRSLPATLPQCQAA
NKTCPTNYMWNNHICRCLAQQDFMFSPNAGDDSADGFQDICGPNKELDEETCQCVCKGGL
RPASCGPHKELDRNSCQCVCKNKLFPSQCGANREFDENTCQCICKRTCPRNQPLNPGKCA
CECTESPQKCLLKGKKFQHQTCSCYRRPCTNRQKPCEPGFSFSEEVCRCVPSYWKRPHMN
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgcacttgctgggcttctctctggcgtgttctctgctcgccgctgcgctgctcccgggt
cctcgcgaggcgcccgctgccgccgccgccgccgccttcgagtccggactcgactactcg
gacgcggagcccgacgccggcgaggccacggcttatgcaagtaaagatctggaggagcag
ttgcggtctgtgtccagtgtagatgaactcatgactgtactctacccagaatattggaaa
atgtacaaatgtcagctcaggaaaggaggctggcaacacagtacagaacaggccaacctc
agctcaaggacagaagagactataaaattcgctgcagcacattataatgcagagatcttg
aaaagtattgataatgagtggagaaagactcaatgcatgccacgggaggtgtgtatagat
gtggggaaggagtctggagctgcaacaaacaccttctttaagcctccatgtgtatccgtc
tacagatgtgggggctgctgcaacagtgaggggctacagtgcatgaacaccagcacaggc
tacctcagcaagacgttatttgaaattacagtgccactctctcaaggccccaagccaata
acagtcagttttgccaatcacacttcctgccgatgcatgtctaaactggatgtttacaga
caagttcattccattattagacgttccctgccagcaacactaccacagtgtcaggcagca
aacaagacttgccccaccaattacatgtggaataatcacatctgcagatgcctggctcag
caagattttatgttttccccaaatgctggagatgactcagcagatggattccaggacatc
tgtggaccaaacaaggagctggatgaagagacctgccaatgtgtctgcaaaggggggctt
cggcctgccagctgcggtccccacaaagaactagacagaaactcatgccagtgtgtctgt
aaaaacaaactcttccccagccaatgtggggccaaccgagaatttgatgaaaacacatgc
cagtgtatatgtaaaagaacctgccccagaaatcaacccctaaatcctggaaaatgtgcc
tgtgaatgtacagaaagtccacagaaatgcttgttaaaaggaaagaagtttcaacaccaa
acatgcagctgttacagacggccatgtacaaaccgccagaagccttgtgagccaggattt
tcatttagtgaggaagtgtgccgttgtgtcccttcatattggaaaagaccacatatgaac
taa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100400081Help
Entry
100400081         CDS       T03264                                 

Gene name
VEGFB
Definition
(RefSeq) vascular endothelial growth factor B
  KO
K16858  vascular endothelial growth factor B
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04014  Ras signaling pathway
cjc04015  Rap1 signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04510  Focal adhesion
cjc04926  Relaxin signaling pathway
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100400081 (VEGFB)
   04015 Rap1 signaling pathway
    100400081 (VEGFB)
   04010 MAPK signaling pathway
    100400081 (VEGFB)
   04151 PI3K-Akt signaling pathway
    100400081 (VEGFB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100400081 (VEGFB)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100400081 (VEGFB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100400081 (VEGFB)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100400081 (VEGFB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100400081 (VEGFB)
Cytokines and growth factors [BR:cjc04052]
 Growth factors
  Growth factors (RTK binding)
   100400081 (VEGFB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDGF VEGF_C
Motif
Other DBs
NCBI-GeneID: 100400081
NCBI-ProteinID: XP_009006644
Position
11
AA seq 395 aa AA seqDB search
MQGQRPRDGDNATLSWRVPRVQVFSLPQAPVSQPDAPGHQKKVVSWIDVYTRATCQPREV
VVPLTVELMGTVAKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRTQHPGPA
PRRPRRPRRHSPPPPFARLPGLLLPPLCYDAMPEIRAREGAVEEPPPAPGPYPPRPGPSH
GAMAATASRATGLGRCGRPQRAAPAGTMNPLLRSLLLATLLQLAPAQAPVSQPDAPGHQK
KVVSWIDVYTRATCQPREVVVPLTVELMGTVAKQLVPSCVTVQRCGGCCPDDGLECVPTG
QHQVRMQILMIRYPSSQLGEMSLEEHSQCECRPKRKNSAVKPDSPRPLCPRCTQRHWRPD
HRTCRCRCRRRSFFRCQGRGLELNPDTCRCRKLRR
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgcaagggcaaagacccagggatggcgacaatgccacactctcctggcgtgtacctcgg
gtccaggtcttttctctcccacaggcccctgtgtcccagcctgatgcccctggccaccag
aagaaagtagtgtcatggatagatgtgtatactcgtgctacctgccagccccgggaggtg
gtggtgcccctgactgtggagctcatgggcaccgtggccaaacagctggtgcccagctgt
gtgaccgtgcagcgctgtggtggctgctgccctgacgatggcctggagtgtgtgcctact
gggcagcaccaagtccggatgcagatcctcatgatccgtacccagcaccccggcccggcc
ccccgtcgcccccgccgtccccgccgccacagcccgccgccaccgttcgcccgcctgccc
ggactcctcctgccgccactgtgttacgatgcgatgcctgaaatcagggctcgggagggg
gccgtggaggagccgccccccgcgcccggcccctacccgccgcgtccgggcccaagccat
ggggctatggctgccaccgcctcccgcgccaccgggctagggcgatgcgggcgcccccag
cgggcggcccctgcgggcaccatgaaccccttactccgcagcctgctgctcgccacactc
ctgcagctggcccccgcccaggcccctgtgtcccagcctgatgcccctggccaccagaag
aaagtagtgtcatggatagatgtgtatactcgtgctacctgccagccccgggaggtggtg
gtgcccctgactgtggagctcatgggcaccgtggccaaacagctggtgcccagctgtgtg
accgtgcagcgctgtggtggctgctgccctgacgatggcctggagtgtgtgcctactggg
cagcaccaagtccggatgcagatcctcatgatccggtacccaagcagtcagctgggggag
atgtccctggaagaacacagccagtgtgaatgcagacctaaaagaaaaaacagtgctgtg
aagccggacagccccaggcccctctgcccacgctgcacccagcgccactggcgccctgac
caccggacctgccgctgccgctgccgacgccgcagcttcttccgttgccaagggcggggc
ttagagctcaacccagacacctgcaggtgccggaaactccgaaggtga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100407908Help
Entry
100407908         CDS       T03264                                 

Gene name
VEGFD
Definition
(RefSeq) vascular endothelial growth factor D
  KO
K05449  vascular endothelial growth factor C/D
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04014  Ras signaling pathway
cjc04015  Rap1 signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04510  Focal adhesion
cjc04926  Relaxin signaling pathway
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100407908 (VEGFD)
   04015 Rap1 signaling pathway
    100407908 (VEGFD)
   04010 MAPK signaling pathway
    100407908 (VEGFD)
   04151 PI3K-Akt signaling pathway
    100407908 (VEGFD)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100407908 (VEGFD)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100407908 (VEGFD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100407908 (VEGFD)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100407908 (VEGFD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100407908 (VEGFD)
Cytokines and growth factors [BR:cjc04052]
 Growth factors
  Growth factors (RTK binding)
   100407908 (VEGFD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDGF
Motif
Other DBs
NCBI-GeneID: 100407908
NCBI-ProteinID: XP_002762692
Ensembl: ENSCJAG00000004194
Position
X
AA seq 356 aa AA seqDB search
MYREWVLVNIFMMLYVQLVQGSSNEQGPVKQSSRSILERSEQQIRAASSLEELLRITHSE
DWKLWRCRVRLKSFTSMDSRSASHRSTRFAATFYDIKTLKVIDEEWQRTQCSPRETCVEV
ASEVGKSTNTFFKPPCVTVFRCGGCCNEESLVCMNTSTSYISKQLFEISVPLTSVPEIVP
VKVANHTGCKCLPTAPRHPVGSSIIRRSIQIPEEDHCSHPKKLCPIDMLWDRNNCKCVLQ
EENPLAGTEDQSHLQEPALCGPHMKFDEDRCECVCKTPCPKDLIQHPKNCSCFECKESLE
SCCQKHKLFHPDTCSCEDRCPFHTRSCANGKPACAKHCRFLKEKKAAQGPHSQQNP
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgtacagagagtgggtactggtgaatattttcatgatgttgtacgtccagctggtgcag
ggctccagtaatgaacaaggaccagtgaagcagtcatcccgatccatattagaacgatct
gaacagcagatcagggctgcttctagtttggaggaactacttcgaattactcactctgag
gactggaagctgtggagatgcagggtgaggctcaaaagttttaccagtatggactctcgc
tcagcatcccatcggtccactaggtttgcagcaactttctatgacataaaaacactaaaa
gttatagatgaagaatggcaaagaactcagtgcagccctagagaaacgtgtgtggaggtc
gccagtgaggtggggaagagtaccaacacattcttcaagcccccttgtgtgaccgtgttc
cgatgtggtggctgttgcaatgaagagagccttgtgtgtatgaacacgagcacctcatat
atttccaaacagctctttgagatatcggtgcctttgacatcagtacctgaaatagtgcct
gttaaagttgccaaccatacaggttgtaagtgcttgccaacagctccccgccatccagtt
ggatcttcaattatcagaagatccatccagatccccgaagaagatcactgttcccatccc
aagaaactctgccctattgacatgctgtgggatcgcaacaactgtaaatgtgttttacag
gaggagaatccacttgctggaacagaagaccagtctcaccttcaggaaccagctctctgt
gggccacacatgaagtttgatgaagatcgttgcgaatgtgtctgtaaaacaccatgtccc
aaagatctgatccagcaccccaaaaactgcagttgctttgagtgcaaagaaagtctggag
agctgctgccagaagcacaagctatttcaccctgacacctgcagctgtgaggacagatgc
ccctttcataccagatcatgtgcaaatggcaaaccagcgtgtgcaaagcactgccgcttt
ctaaaggagaaaaaggctgcccaggggccccacagccaacagaatccttga

DBGET integrated database retrieval system