KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100389654Help
Entry
100389654         CDS       T03264                                 

Gene name
HSD3B1
Definition
(RefSeq) 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1
  KO
K00070  3beta-hydroxy-Delta5-steroid dehydrogenase / steroid Delta-isomerase [EC:1.1.1.145 5.3.3.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00140  Steroid hormone biosynthesis
cjc01100  Metabolic pathways
cjc04913  Ovarian steroidogenesis
cjc04925  Aldosterone synthesis and secretion
cjc04927  Cortisol synthesis and secretion
cjc04934  Cushing syndrome
Module
cjc_M00107  Steroid hormone biosynthesis, cholesterol => prognenolone => progesterone
cjc_M00110  C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    100389654 (HSD3B1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    100389654 (HSD3B1)
   04925 Aldosterone synthesis and secretion
    100389654 (HSD3B1)
   04927 Cortisol synthesis and secretion
    100389654 (HSD3B1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100389654 (HSD3B1)
Enzymes [BR:cjc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.145  3beta-hydroxy-Delta5-steroid dehydrogenase
     100389654 (HSD3B1)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.1  steroid Delta-isomerase
     100389654 (HSD3B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3Beta_HSD Epimerase NAD_binding_4 GDP_Man_Dehyd Polysacc_synt_2 NAD_binding_10 RmlD_sub_bind
Motif
Other DBs
NCBI-GeneID: 100389654
NCBI-ProteinID: XP_002763679
Position
7
AA seq 354 aa AA seqDB search
LNTYVTSPLPENFPARSRNPSIDLTCVHTELQKKTKLTMLEGDILDEPCLKTACQDVTVV
IHTASVIDVFGAVHRQSIMNVNVKGTQLLLEACVHASVPVFIYTSSVEVAGPSSYKEVIQ
NGHEDQPLESTLSAPYPHSKRLAEKAVLAANGWTLKNGGTLYTCALRPMYIYGEGSPFLS
ATVNEALDNRGILPSTGKFSTVNPVYVGNVAWAHILALRALQDPRKAPSVQGQFYYISDD
TPHQSYDAFNYSLSKEFGLRLDSSWSLPLVLRYWVAFLLEAVSFLLSPIYTYRPPFNRHT
VTLSNSTYTFSYKKAQRDLAYKPLYSWEEARQKTMEWVGSLVDRHKETLKPKTQ
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
ttgaacacctatgtaacatcacctttaccagagaacttcccagccagatccagaaaccct
tccattgacctgacctgtgttcacacagagctccagaagaagaccaagctgacgatgctg
gaaggagacattctggatgagccatgcctgaagacagcctgccaggacgtcacggtcgtc
atccacacggcctctgtcatcgatgtctttggcgccgttcacagacagtccatcatgaac
gtcaacgtgaaaggtacccagctcctgttggaagcctgtgtccacgctagtgtgccagtc
ttcatctacaccagcagcgtagaggtggccgggcccagctcctacaaggaagtcatccag
aacggtcatgaagatcagcctctggaaagcacattgtctgctccctatccacacagcaaa
cggcttgctgagaaggctgtgctggcggctaatgggtggactctgaaaaacggtggcacc
ttgtacacttgtgccttaagacccatgtacatctatggggaaggaagcccattcctttct
gccacagtaaatgaagccctcgacaacagggggatcctgccaagtactggcaagttctcc
acagtcaacccagtgtatgttggcaacgtggcctgggcccacattctggccttgagggcc
ctgcaggaccccaggaaggccccaagtgtccaaggacagttctattacatctcagacgac
acacctcaccaaagctatgatgcctttaattacagcctgagcaaagagttcggcctccgc
cttgattccagttggagccttcctctagtcctgaggtactgggttgccttcctgctggaa
gcagtgagcttcctgctcagcccaatttacacctatcgaccccccttcaaccggcacaca
gtgacattgtcaaatagcacgtacaccttctcttacaagaaggctcagcgagatctggca
tataagccgctctacagctgggaggaagccaggcagaaaaccatggagtgggttggttcc
cttgtggaccggcacaaggagacgctgaagcccaagactcagtga

DBGET integrated database retrieval system