KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100389780Help
Entry
100389780         CDS       T03264                                 

Gene name
CCL5
Definition
(RefSeq) C-C motif chemokine ligand 5
  KO
K12499  C-C motif chemokine 5
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04062  Chemokine signaling pathway
cjc04620  Toll-like receptor signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04623  Cytosolic DNA-sensing pathway
cjc04668  TNF signaling pathway
cjc05020  Prion diseases
cjc05142  Chagas disease (American trypanosomiasis)
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05168  Herpes simplex virus 1 infection
cjc05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100389780 (CCL5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100389780 (CCL5)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100389780 (CCL5)
   04621 NOD-like receptor signaling pathway
    100389780 (CCL5)
   04623 Cytosolic DNA-sensing pathway
    100389780 (CCL5)
   04062 Chemokine signaling pathway
    100389780 (CCL5)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    100389780 (CCL5)
  09164 Neurodegenerative disease
   05020 Prion diseases
    100389780 (CCL5)
  09172 Infectious disease: viral
   05164 Influenza A
    100389780 (CCL5)
   05168 Herpes simplex virus 1 infection
    100389780 (CCL5)
   05163 Human cytomegalovirus infection
    100389780 (CCL5)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    100389780 (CCL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100389780 (CCL5)
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100389780 (CCL5)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Chemokines
   100389780 (CCL5)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate/Haparin
  Chemokines
   100389780 (CCL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 100389780
NCBI-ProteinID: XP_002748382
Ensembl: ENSCJAG00000015021
Position
5
AA seq 91 aa AA seqDB search
MKVSVAALAVILVATTLCAPVSATPYASDTTPCCFAYIVRLLPRAHIKEYFYTSGKCSIP
AVVFVTRKNRQVCANPEKKWVREYINSLEMS
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtctccgtggctgccctcgctgtcatcctggttgctaccaccctctgcgctcct
gtatctgccaccccatatgcctcagacaccacaccctgctgctttgcctacattgtccgc
ctgttgccccgtgcccacatcaaggagtatttctacaccagtggcaagtgctccatccca
gcagtcgtctttgtcacccgaaagaaccgccaggtgtgtgccaacccagagaagaagtgg
gttcgggaatacatcaactctttggagatgagctag

DBGET integrated database retrieval system