KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100389870Help
Entry
100389870         CDS       T03264                                 

Gene name
CXCL2
Definition
(RefSeq) chemokine (C-X-C motif) ligand 2
  KO
K05505  C-X-C motif chemokine 1/2/3
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04062  Chemokine signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04657  IL-17 signaling pathway
cjc04668  TNF signaling pathway
cjc05132  Salmonella infection
cjc05134  Legionellosis
cjc05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100389870 (CXCL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100389870 (CXCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100389870 (CXCL2)
   04657 IL-17 signaling pathway
    100389870 (CXCL2)
   04062 Chemokine signaling pathway
    100389870 (CXCL2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100389870 (CXCL2)
   05134 Legionellosis
    100389870 (CXCL2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100389870 (CXCL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100389870 (CXCL2)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Chemokines
   100389870 (CXCL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 100389870
NCBI-ProteinID: XP_002745777
Ensembl: ENSCJAG00000013908
Position
3
AA seq 109 aa AA seqDB search
MARAALSADSSNPRLLRAALLFLLLVAAGRRAAGAPLANELRCHCLQTLQGIHLKNIQSV
EVKRPGPHCDQTEVIATLKNGQKACLNPASPIVKKIIEKILNRESTKQE
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcgccgcgctctccgccgattccagcaacccccggctcctgcgggcggcgctg
ctgttcctgctcctggtggccgccggccggcgcgcagcaggagctcccctggccaatgaa
ctgcgctgccattgtctgcagaccctgcagggaattcacctcaagaacatccaaagtgtg
gaagtgaagcggccgggaccccactgcgaccaaaccgaagtcatagccacactcaagaat
gggcagaaagcttgtctgaaccccgcatcccccattgttaagaaaatcatagaaaagatt
ctgaacagggagagcaccaaacaggagtga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100400489Help
Entry
100400489         CDS       T03264                                 

Gene name
CXCL2
Definition
(RefSeq) C-X-C motif chemokine ligand 2
  KO
K05505  C-X-C motif chemokine 1/2/3
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04062  Chemokine signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04657  IL-17 signaling pathway
cjc04668  TNF signaling pathway
cjc05132  Salmonella infection
cjc05134  Legionellosis
cjc05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100400489 (CXCL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100400489 (CXCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100400489 (CXCL2)
   04657 IL-17 signaling pathway
    100400489 (CXCL2)
   04062 Chemokine signaling pathway
    100400489 (CXCL2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100400489 (CXCL2)
   05134 Legionellosis
    100400489 (CXCL2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100400489 (CXCL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100400489 (CXCL2)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Chemokines
   100400489 (CXCL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 100400489
NCBI-ProteinID: XP_002745799
Ensembl: ENSCJAG00000013908
UniProt: F6YXL6
Position
3
AA seq 107 aa AA seqDB search
MARAALSADSSNPRLLRAALLLLLLVAAGRRAAGAPLANELRCHCLQTLQGIHLKNIQSV
EVKQPGPHCDQTEVIATLKNGQKACLNPASPMVKKIIEKILNSGKSN
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcgccgcgctctccgccgactccagtaacccccggctcctgcgggcggcgctg
ctgctcctgctcctggtggccgccggccggcgcgcagcaggagctcccctggccaatgaa
ctgcgctgccattgtctgcagaccctgcagggaattcacctcaagaacatccaaagtgtg
gaagtgaagcaaccgggaccccactgcgaccaaaccgaagtcatagccacactcaagaat
gggcagaaagcttgtctgaaccccgcatcccccatggttaagaaaatcatcgaaaagatt
ctgaacagtggcaaatccaactga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100401955Help
Entry
100401955         CDS       T03264                                 

Gene name
CXCL1
Definition
(RefSeq) chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha)
  KO
K05505  C-X-C motif chemokine 1/2/3
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04062  Chemokine signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04657  IL-17 signaling pathway
cjc04668  TNF signaling pathway
cjc05132  Salmonella infection
cjc05134  Legionellosis
cjc05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100401955 (CXCL1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100401955 (CXCL1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100401955 (CXCL1)
   04657 IL-17 signaling pathway
    100401955 (CXCL1)
   04062 Chemokine signaling pathway
    100401955 (CXCL1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100401955 (CXCL1)
   05134 Legionellosis
    100401955 (CXCL1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100401955 (CXCL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100401955 (CXCL1)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Chemokines
   100401955 (CXCL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 100401955
NCBI-ProteinID: XP_002745802
Ensembl: ENSCJAG00000013925
Position
3
AA seq 107 aa AA seqDB search
MARAALSADSSNPRLLRAALLLLLLVAAGRRAAGAPLANELRCHCLQTLQGIHLKNIQSV
EVKRPGPHCDQTEVIAALKNGQKACLNPASPIVKKIIEKILNSDKPN
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcgccgcgctctccgccgattccagcaacccccggctcctgcgggcggcgctg
ctgctcctgctcctggtggccgccggccggcgcgcagcaggagctcccctggccaatgaa
ctgcgctgccattgtctgcagaccctgcagggaattcacctcaagaacatccaaagtgtg
gaagtgaagcggccgggaccccactgcgaccaaaccgaagtcatagccgcactcaagaat
gggcagaaagcttgtctgaaccccgcatcccccattgttaagaaaatcatcgaaaagatt
ctgaacagtgacaaacccaactga

DBGET integrated database retrieval system