KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100389944Help
Entry
100389944         CDS       T03264                                 

Gene name
PDPK1
Definition
(RefSeq) 3-phosphoinositide dependent protein kinase 1
  KO
K06276  3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01524  Platinum drug resistance
cjc03320  PPAR signaling pathway
cjc04068  FoxO signaling pathway
cjc04071  Sphingolipid signaling pathway
cjc04140  Autophagy - animal
cjc04150  mTOR signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04152  AMPK signaling pathway
cjc04210  Apoptosis
cjc04510  Focal adhesion
cjc04660  T cell receptor signaling pathway
cjc04664  Fc epsilon RI signaling pathway
cjc04722  Neurotrophin signaling pathway
cjc04910  Insulin signaling pathway
cjc04919  Thyroid hormone signaling pathway
cjc04931  Insulin resistance
cjc04960  Aldosterone-regulated sodium reabsorption
cjc05145  Toxoplasmosis
cjc05205  Proteoglycans in cancer
cjc05213  Endometrial cancer
cjc05215  Prostate cancer
cjc05223  Non-small cell lung cancer
cjc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100389944 (PDPK1)
   04071 Sphingolipid signaling pathway
    100389944 (PDPK1)
   04151 PI3K-Akt signaling pathway
    100389944 (PDPK1)
   04152 AMPK signaling pathway
    100389944 (PDPK1)
   04150 mTOR signaling pathway
    100389944 (PDPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100389944 (PDPK1)
  09143 Cell growth and death
   04210 Apoptosis
    100389944 (PDPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100389944 (PDPK1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100389944 (PDPK1)
   04664 Fc epsilon RI signaling pathway
    100389944 (PDPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100389944 (PDPK1)
   03320 PPAR signaling pathway
    100389944 (PDPK1)
   04919 Thyroid hormone signaling pathway
    100389944 (PDPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100389944 (PDPK1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100389944 (PDPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100389944 (PDPK1)
   05231 Choline metabolism in cancer
    100389944 (PDPK1)
  09162 Cancer: specific types
   05215 Prostate cancer
    100389944 (PDPK1)
   05213 Endometrial cancer
    100389944 (PDPK1)
   05223 Non-small cell lung cancer
    100389944 (PDPK1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100389944 (PDPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100389944 (PDPK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100389944 (PDPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100389944 (PDPK1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100389944 (PDPK1)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100389944 (PDPK1)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: AGC group
  PDK1 family
   100389944 (PDPK1)
Membrane trafficking [BR:cjc04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    100389944 (PDPK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase PH_3 Pkinase_Tyr Kinase-like Haspin_kinase Pkinase_fungal APH Kdo YukC
Motif
Other DBs
NCBI-GeneID: 100389944
NCBI-ProteinID: XP_003734434
Ensembl: ENSCJAG00000014801
UniProt: F7HA88
Position
12
AA seq 556 aa AA seqDB search
MARTTSQLYDAVPIQSSVVLCSCPSPSMVRTQTESSTAPGVPGGSRQGPAMDGTAAEPRP
SAGSLQHTQPPQQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIK
ENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDET
CTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARAN
SFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYD
FPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESITWENLHQQTPPKLTA
YLPAMSEDDEDCYGNYDNLLSQFGCMQVSSSSSSHSLSASEAGLPQRSGSNIEQYIHDLD
SNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTE
GPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQ
EVWRQRYQSHPDAAVQ
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atggctaggaccaccagccagctgtatgacgccgtgcccatccagtccagcgtggtgtta
tgttcctgcccgtccccatcaatggtgaggacccagactgagtccagcacggcccctggt
gttcctggtggcagcaggcagggccccgccatggatggcactgcagccgagcctcggccc
agtgccggctccctgcaacacacccagccgccgcagcagcctcggaagaagcggcctgag
gacttcaagttcgggaaaattcttggggaaggctctttttccacagttgtcctggctcga
gaactggcaacctccagagaatatgcgattaaaattctggagaagcgacatatcataaaa
gagaacaaggtcccatatgtaaccagagagcgggatgtgatgtcgcgcctggatcacccc
ttctttgttaagctttacttcacgtttcaggacgacgagaagctgtatttcggccttagt
tatgccaaaaatggagaactacttaaatatattcgcaaaattggttcattcgatgagacc
tgtacccggttttacacggctgagattgtgtctgcgttagagtacttgcacggcaagggt
atcattcacagggaccttaaaccagaaaacattttgttaaatgaagatatgcacatccag
atcacagactttggaacagcaaaagtattgtccccagagagcaaacaagccagggccaac
tcgtttgtgggaacagcgcagtacgtttctccagagctgctcacagagaagtccgcctgt
aagagttcagacctctgggctcttggatgcataatataccagcttgttgcaggactccca
ccattccgagctggaaatgagtatcttatatttcagaagatcattaagttggaatatgac
tttccagaaaaattcttccctaaggcaagagaccttgtggaaaaacttttggttttagat
gccacaaagcggttaggctgtgaggaaatggaagggtacggacctcttaaggcacacccc
ttcttcgagtccatcacgtgggagaacctgcaccagcagacgcctccgaagctcaccgct
tacctgccagccatgtcggaagacgacgaggactgctacggcaactacgacaatctcctg
agccagtttggctgcatgcaggtgtcctcatcatcctcctcacactccctgtcagcctcg
gaagcgggcctgccccagaggtcaggtagcaacatagagcagtacatccacgacctggac
tcgaactcctttgaactggacttacagttttccgaagatgagaagaggctgttactggag
aagcaagctggcggaaacccttggcaccaatttgtagaaaataatttaatactaaagatg
ggcccggtggataagcggaagggtttatttgcacgaagacgacagttgttgctcacagaa
ggaccacatttatattacgtggatcctgtcaacaaggtcctgaaaggtgaaattccttgg
tcacaagaacttcgaccagaagccaagaattttaaaactttctttgtccacacgcctaac
aggacatattatctgatggaccccagcggaaatgcacacaaatggtgcaggaagatccag
gaggtttggaggcagcgataccagagccacccggatgccgcggtccagtga

DBGET integrated database retrieval system