KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100390012Help
Entry
100390012         CDS       T03264                                 

Gene name
CD40LG, CD40-L, CD40L, TNFSF5, TNLG8B
Definition
(RefSeq) CD40 ligand
  KO
K03161  tumor necrosis factor ligand superfamily member 5
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04064  NF-kappa B signaling pathway
cjc04514  Cell adhesion molecules (CAMs)
cjc04660  T cell receptor signaling pathway
cjc04672  Intestinal immune network for IgA production
cjc05144  Malaria
cjc05145  Toxoplasmosis
cjc05310  Asthma
cjc05320  Autoimmune thyroid disease
cjc05322  Systemic lupus erythematosus
cjc05330  Allograft rejection
cjc05340  Primary immunodeficiency
cjc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100390012 (CD40LG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100390012 (CD40LG)
   04514 Cell adhesion molecules (CAMs)
    100390012 (CD40LG)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100390012 (CD40LG)
   04672 Intestinal immune network for IgA production
    100390012 (CD40LG)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    100390012 (CD40LG)
   05322 Systemic lupus erythematosus
    100390012 (CD40LG)
   05320 Autoimmune thyroid disease
    100390012 (CD40LG)
   05330 Allograft rejection
    100390012 (CD40LG)
   05340 Primary immunodeficiency
    100390012 (CD40LG)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100390012 (CD40LG)
  09174 Infectious disease: parasitic
   05144 Malaria
    100390012 (CD40LG)
   05145 Toxoplasmosis
    100390012 (CD40LG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100390012 (CD40LG)
   04090 CD molecules [BR:cjc04090]
    100390012 (CD40LG)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Tumor necrosis fators
   100390012 (CD40LG)
CD molecules [BR:cjc04090]
 Proteins
  100390012 (CD40LG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF LRR19-TM
Motif
Other DBs
NCBI-GeneID: 100390012
NCBI-ProteinID: NP_001254684
Ensembl: ENSCJAG00000003696
UniProt: Q9BDN3
Position
X
AA seq 261 aa AA seqDB search
MIETYNQPVPRSAATGPPVSMKIFMYLLTVFLITQMIGSALFAVYLHRRLDKIEDERNLH
EDFVFMKTIQRCNTGERSLSLLNCEEIKSQFEGFVKDIMLNKEEKKKENSFEMQKGDQNP
QIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQLTVKRQGLYYIYAQVTFCSN
REASSQAPFIASLCLKPPNRFERILLRAANTHSSAKPCGQQSIHLGGIFELQPGASVFVN
VTDPSQVSHGTGFTSFGLLKL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaacatacaaccaacctgttccccgatctgcagccactggaccgcccgtcagc
atgaaaatttttatgtatttacttactgtttttcttatcacccagatgattgggtcagca
ctttttgctgtgtatcttcatagaaggttggacaagatagaagatgaaaggaatcttcat
gaagattttgtattcatgaaaacaatacagagatgcaacacaggagaaagatccttatcc
ttactgaactgtgaagagattaaaagccagtttgaaggctttgtgaaggatataatgcta
aacaaagaggagaagaagaaagaaaatagctttgaaatgcaaaaaggtgatcagaatcct
caaattgcggcgcatgtcataagtgaggccagtagtaaaacaacatctgtgctacagtgg
gctgaaaaaggatactacaccatgagcaacaacttggtaaccctggaaaatgggaaacag
ctgaccgttaaaagacaaggactctattatatctatgcccaagtcaccttctgttccaat
cgggaagcttcgagtcaagctccatttatagccagcctctgcctaaagccccccaataga
ttcgagagaatcttactcagagccgcaaatacccacagttctgccaaaccttgcgggcaa
caatccattcacttgggaggaatatttgaattgcaaccaggtgcctcggtgtttgtcaat
gtgactgatccaagccaagtgagccacggcaccggcttcacgtcctttggcttactcaaa
ctctga

DBGET integrated database retrieval system