KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100390054Help
Entry
100390054         CDS       T03264                                 

Gene name
FOS
Definition
(RefSeq) Fos proto-oncogene, AP-1 transcription factor subunit
  KO
K04379  proto-oncogene protein c-fos
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01522  Endocrine resistance
cjc04010  MAPK signaling pathway
cjc04024  cAMP signaling pathway
cjc04210  Apoptosis
cjc04380  Osteoclast differentiation
cjc04620  Toll-like receptor signaling pathway
cjc04657  IL-17 signaling pathway
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04660  T cell receptor signaling pathway
cjc04662  B cell receptor signaling pathway
cjc04668  TNF signaling pathway
cjc04713  Circadian entrainment
cjc04725  Cholinergic synapse
cjc04728  Dopaminergic synapse
cjc04915  Estrogen signaling pathway
cjc04917  Prolactin signaling pathway
cjc04921  Oxytocin signaling pathway
cjc04926  Relaxin signaling pathway
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc05031  Amphetamine addiction
cjc05132  Salmonella infection
cjc05133  Pertussis
cjc05140  Leishmaniasis
cjc05142  Chagas disease (American trypanosomiasis)
cjc05161  Hepatitis B
cjc05162  Measles
cjc05166  Human T-cell leukemia virus 1 infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05210  Colorectal cancer
cjc05224  Breast cancer
cjc05231  Choline metabolism in cancer
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cjc05323  Rheumatoid arthritis
cjc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100390054 (FOS)
   04668 TNF signaling pathway
    100390054 (FOS)
   04024 cAMP signaling pathway
    100390054 (FOS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100390054 (FOS)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100390054 (FOS)
   04660 T cell receptor signaling pathway
    100390054 (FOS)
   04658 Th1 and Th2 cell differentiation
    100390054 (FOS)
   04659 Th17 cell differentiation
    100390054 (FOS)
   04657 IL-17 signaling pathway
    100390054 (FOS)
   04662 B cell receptor signaling pathway
    100390054 (FOS)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100390054 (FOS)
   04917 Prolactin signaling pathway
    100390054 (FOS)
   04921 Oxytocin signaling pathway
    100390054 (FOS)
   04926 Relaxin signaling pathway
    100390054 (FOS)
   04928 Parathyroid hormone synthesis, secretion and action
    100390054 (FOS)
  09156 Nervous system
   04725 Cholinergic synapse
    100390054 (FOS)
   04728 Dopaminergic synapse
    100390054 (FOS)
  09158 Development
   04380 Osteoclast differentiation
    100390054 (FOS)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100390054 (FOS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100390054 (FOS)
   05231 Choline metabolism in cancer
    100390054 (FOS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100390054 (FOS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100390054 (FOS)
   05224 Breast cancer
    100390054 (FOS)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100390054 (FOS)
  09165 Substance dependence
   05031 Amphetamine addiction
    100390054 (FOS)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100390054 (FOS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100390054 (FOS)
   05133 Pertussis
    100390054 (FOS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100390054 (FOS)
   05170 Human immunodeficiency virus 1 infection
    100390054 (FOS)
   05162 Measles
    100390054 (FOS)
   05161 Hepatitis B
    100390054 (FOS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100390054 (FOS)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100390054 (FOS)
   05142 Chagas disease (American trypanosomiasis)
    100390054 (FOS)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100390054 (FOS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100390054 (FOS)
   04131 Membrane trafficking [BR:cjc04131]
    100390054 (FOS)
Transcription factors [BR:cjc03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    100390054 (FOS)
Membrane trafficking [BR:cjc04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    100390054 (FOS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Macoilin DUF3450 HALZ
Motif
Other DBs
NCBI-GeneID: 100390054
NCBI-ProteinID: XP_002754167
Ensembl: ENSCJAG00000020633
UniProt: F7I4Q5
Position
10
AA seq 380 aa AA seqDB search
MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNGQDFCTDLAVSSANF
IPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPTPSAGAYSRAGVVKTMTGGRA
QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ
TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEDMSVASLDLTGGLPEAATPESEEAFS
LPLLNDPEPKPSVEPVKSISSMELKAEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA
ADWEPLHGGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRK
GSSSNEPSSDSLSSPTLLAL
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgatgttctctggcttcaacgcagactacgaggcgtcctcctcccgctgcagcagcgcg
tccccggcaggggacagcctctcctactaccactcacccgctgactccttctccagcatg
ggctcgcctgtcaacggccaggacttctgcacggacctggctgtctccagtgccaacttc
attccgacggtcactgccatctcgaccagtcccgacctgcaatggctggtgcagcccgcc
ctcgtctcctccgtggccccatcgcagaccagagcccctcaccccttcggagtccccact
ccctccgctggggcttactctagggccggcgttgtgaagaccatgacaggcggccgagca
cagagcattggcaggaggggcaaggtggaacagttatctccagaagaagaagagaaaagg
agaatccgaagggaaaggaataagatggctgcagccaaatgccgcaaccggaggagggag
ctgactgatacactccaagcggagacagaccaactggaagatgagaagtctgctttgcag
accgagattgccaacctgctgaaggagaaggaaaaactagagttcatcctggctgctcac
cgacctgcctgcaagatccctgatgacctgggcttcccagaagacatgtctgtggcttcc
cttgacctgactgggggcctgccagaggctgccactccggagtctgaggaggccttcagc
ctgcctctcctcaatgaccctgagcccaagccctcagtggagcctgtcaagagcatcagc
agtatggagctgaaagctgagccctttgatgacttcctgttcccagcatcatccaggccc
agtggctctgagacggcccgctctgtgccagacatggacctgtctgggtccttctatgca
gcagactgggagcccctgcatggtggctccctggggatggggcccatggccacagagctg
gagcccctgtgcactccggtggtcacctgcactcccagctgcactgcttacacgtcttcc
ttcgtcttcacctaccccgaggctgactccttccccagctgcgcagctgcccatcgcaag
ggcagcagcagcaatgagccctcctctgactcgctcagctcacccacactgctggccctg
tga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100400411Help
Entry
100400411         CDS       T03264                                 

Gene name
JUN
Definition
(RefSeq) Jun proto-oncogene, AP-1 transcription factor subunit
  KO
K04448  transcription factor AP-1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01522  Endocrine resistance
cjc04010  MAPK signaling pathway
cjc04012  ErbB signaling pathway
cjc04024  cAMP signaling pathway
cjc04137  Mitophagy - animal
cjc04210  Apoptosis
cjc04310  Wnt signaling pathway
cjc04380  Osteoclast differentiation
cjc04510  Focal adhesion
cjc04530  Tight junction
cjc04620  Toll-like receptor signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04625  C-type lectin receptor signaling pathway
cjc04657  IL-17 signaling pathway
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04660  T cell receptor signaling pathway
cjc04662  B cell receptor signaling pathway
cjc04668  TNF signaling pathway
cjc04722  Neurotrophin signaling pathway
cjc04912  GnRH signaling pathway
cjc04915  Estrogen signaling pathway
cjc04921  Oxytocin signaling pathway
cjc04926  Relaxin signaling pathway
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc05030  Cocaine addiction
cjc05031  Amphetamine addiction
cjc05132  Salmonella infection
cjc05133  Pertussis
cjc05140  Leishmaniasis
cjc05142  Chagas disease (American trypanosomiasis)
cjc05161  Hepatitis B
cjc05162  Measles
cjc05166  Human T-cell leukemia virus 1 infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05203  Viral carcinogenesis
cjc05210  Colorectal cancer
cjc05211  Renal cell carcinoma
cjc05224  Breast cancer
cjc05231  Choline metabolism in cancer
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cjc05321  Inflammatory bowel disease (IBD)
cjc05323  Rheumatoid arthritis
cjc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100400411 (JUN)
   04012 ErbB signaling pathway
    100400411 (JUN)
   04310 Wnt signaling pathway
    100400411 (JUN)
   04668 TNF signaling pathway
    100400411 (JUN)
   04024 cAMP signaling pathway
    100400411 (JUN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100400411 (JUN)
  09143 Cell growth and death
   04210 Apoptosis
    100400411 (JUN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100400411 (JUN)
   04530 Tight junction
    100400411 (JUN)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100400411 (JUN)
   04621 NOD-like receptor signaling pathway
    100400411 (JUN)
   04625 C-type lectin receptor signaling pathway
    100400411 (JUN)
   04660 T cell receptor signaling pathway
    100400411 (JUN)
   04658 Th1 and Th2 cell differentiation
    100400411 (JUN)
   04659 Th17 cell differentiation
    100400411 (JUN)
   04657 IL-17 signaling pathway
    100400411 (JUN)
   04662 B cell receptor signaling pathway
    100400411 (JUN)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100400411 (JUN)
   04915 Estrogen signaling pathway
    100400411 (JUN)
   04921 Oxytocin signaling pathway
    100400411 (JUN)
   04926 Relaxin signaling pathway
    100400411 (JUN)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100400411 (JUN)
  09158 Development
   04380 Osteoclast differentiation
    100400411 (JUN)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100400411 (JUN)
   05203 Viral carcinogenesis
    100400411 (JUN)
   05231 Choline metabolism in cancer
    100400411 (JUN)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100400411 (JUN)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100400411 (JUN)
   05211 Renal cell carcinoma
    100400411 (JUN)
   05224 Breast cancer
    100400411 (JUN)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100400411 (JUN)
   05321 Inflammatory bowel disease (IBD)
    100400411 (JUN)
  09165 Substance dependence
   05030 Cocaine addiction
    100400411 (JUN)
   05031 Amphetamine addiction
    100400411 (JUN)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100400411 (JUN)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100400411 (JUN)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100400411 (JUN)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100400411 (JUN)
   05133 Pertussis
    100400411 (JUN)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100400411 (JUN)
   05170 Human immunodeficiency virus 1 infection
    100400411 (JUN)
   05162 Measles
    100400411 (JUN)
   05161 Hepatitis B
    100400411 (JUN)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100400411 (JUN)
   05169 Epstein-Barr virus infection
    100400411 (JUN)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100400411 (JUN)
   05142 Chagas disease (American trypanosomiasis)
    100400411 (JUN)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100400411 (JUN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100400411 (JUN)
Transcription factors [BR:cjc03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    100400411 (JUN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 Fib_alpha Jnk-SapK_ap_N FlaC_arch NBP1 TSC22 DUF3450 TFIIA
Motif
Other DBs
NCBI-GeneID: 100400411
NCBI-ProteinID: XP_002750926
UniProt: U3ED65
Position
7
AA seq 334 aa AA seqDB search
MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTHPSVTSAAQPVSGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA
LSSGGGAPSYGAAGLAFPAQPQQQQQPPQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPG
ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST
ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaaagatggaaacgaccttctatgacgatgccctcaacgcctcgttcctccag
tccgagagcggagcttatggctacagtaaccccaagatcctgaaacagagtatgaccctg
aacctggccgacccagtggggagcctgaagccgcaccttcgcgccaagaactcggacctc
ctcacctcgcccgacgtggggctgctcaagctggcgtctcccgagctggagcgcctcatc
atccagtccagcaatgggcacattaccaccacgccgacccccacccagttcttgtgcccc
aagaacgtgacagacgagcaggagggcttcgccgagggtttcgtgcgcgccctggccgag
ctgcacagccagaacacacatcccagcgtcacgtcggcggcgcagccggtcagcggggcg
ggcatggtggctcccgcggtggcctcggtggcggggggcagtggcagcggcggcttcagc
gccagcctgcacagcgagccgccggtctacgccaacctcagcaacttcaaccccggagcg
ctgagcagcggcggcggggcgccctcctacggcgcggccggcctggcctttcccgcgcaa
ccccagcagcagcagcagccgccgcagccgccccaccacttgccccagcagatgccggtg
cagcacccgcgactgcaggccctgaaggaggagcctcagacagtgcccgagatgcccggc
gagacgccgcccctgtcccccatcgacatggagtcccaggagcggatcaaggcagagagg
aagcgcatgaggaaccgcatcgctgcctccaagtgccgaaaaaggaagctggagagaatc
gcccggctggaggaaaaagtgaaaaccttgaaagctcagaactcggagctggcgtccacg
gccaacatgctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaac
agtgggtgccaactcatgctaacgcagcagttgcaaacgttttga

DBGET integrated database retrieval system