KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100390235Help
Entry
100390235         CDS       T03264                                 

Gene name
E2F3
Definition
(RefSeq) E2F transcription factor 3
  KO
K06620  transcription factor E2F3
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01522  Endocrine resistance
cjc04110  Cell cycle
cjc04218  Cellular senescence
cjc04934  Cushing syndrome
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05163  Human cytomegalovirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05169  Epstein-Barr virus infection
cjc05200  Pathways in cancer
cjc05206  MicroRNAs in cancer
cjc05212  Pancreatic cancer
cjc05214  Glioma
cjc05215  Prostate cancer
cjc05218  Melanoma
cjc05219  Bladder cancer
cjc05220  Chronic myeloid leukemia
cjc05222  Small cell lung cancer
cjc05223  Non-small cell lung cancer
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Module
cjc_M00692  Cell cycle - G1/S transition
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100390235 (E2F3)
   04218 Cellular senescence
    100390235 (E2F3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100390235 (E2F3)
   05206 MicroRNAs in cancer
    100390235 (E2F3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100390235 (E2F3)
   05225 Hepatocellular carcinoma
    100390235 (E2F3)
   05226 Gastric cancer
    100390235 (E2F3)
   05214 Glioma
    100390235 (E2F3)
   05220 Chronic myeloid leukemia
    100390235 (E2F3)
   05218 Melanoma
    100390235 (E2F3)
   05219 Bladder cancer
    100390235 (E2F3)
   05215 Prostate cancer
    100390235 (E2F3)
   05224 Breast cancer
    100390235 (E2F3)
   05222 Small cell lung cancer
    100390235 (E2F3)
   05223 Non-small cell lung cancer
    100390235 (E2F3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100390235 (E2F3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100390235 (E2F3)
   05161 Hepatitis B
    100390235 (E2F3)
   05160 Hepatitis C
    100390235 (E2F3)
   05163 Human cytomegalovirus infection
    100390235 (E2F3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100390235 (E2F3)
   05169 Epstein-Barr virus infection
    100390235 (E2F3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100390235 (E2F3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100390235 (E2F3)
Transcription factors [BR:cjc03000]
 Eukaryotic Type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    100390235 (E2F3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E2F_CC-MB E2F_TDP
Motif
Other DBs
NCBI-GeneID: 100390235
NCBI-ProteinID: XP_008992147
Ensembl: ENSCJAG00000019544
Position
4
AA seq 334 aa AA seqDB search
MPLQQQAKRRLELGESGHQYLSDGLKTPKGKGRAALRSPDSPKKKTRYDTSLGLLTKKFI
QLLSQSPDGVLDLNKAAEVLKVQKRRIYDITNVLEGIHLIKKKSKNNVQWMGCSLSEDGG
MLAQCQGLSKEVTELSQEEKKLDELIQSCTLDLKLLTEDSENQRLAYVTYQDIRKISGLK
DQTVIVVKAPPETRLEVPDSIESLQIHLASTQGPIEVYLCPEETETHSPMKTSNQDHNGN
IPKPTSKDLASTNSGHSDCSISMGNLSPLASPSNLLQQTEDQIPSSLEGPFVNLLPPLLQ
EDYLLSLGEEEGISDLFEAYDLEKLPLVEDFMCS
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgcccttacagcagcaggcaaagcgaaggctggagctaggagaaagcggtcaccagtac
ctctcagatggtttaaaaacccccaagggcaaaggaagagctgcactacgaagtccagat
agtccaaaaaaaaaaacgcggtatgatacgtcccttggtctgctcaccaagaagttcatt
cagctcctgagccagtcacccgatggggtcttggatttgaacaaggcagcagaagtgctc
aaagtgcaaaagagaaggatttatgatatcaccaacgttctggaaggcatccacctcatt
aagaagaagtctaagaacaacgtccagtggatgggctgcagtctgtctgaggatgggggc
atgctggcccagtgtcaaggcctgtcaaaagaagtgaccgagctcagtcaggaagagaag
aaattagatgaactgatccaaagctgcaccctggacctcaaactgttaaccgaggattca
gagaatcaaaggttagcttatgttacatatcaagatattcgaaaaattagtggccttaaa
gaccaaactgttatagttgtgaaagcccctccagaaacaagacttgaagtgcctgactca
atagagagcctacaaatacatttggcaagtacccaagggcccattgaggtttacttatgt
ccagaagagactgaaacacacagtccaatgaaaacaagcaaccaagaccacaatgggaat
atccctaaacccacttccaaagacttggcttcaaccaactcaggacatagcgattgctca
atttctatgggaaacctttctcctctggcctccccatccaacctcttacagcagactgag
gaccaaattccttccagcctagaagggccgtttgtgaacttactgcctcccctgctgcaa
gaggactatctcctgagcctcggggaggaggaaggcatcagcgatctctttgaagcttat
gatctggaaaagctcccactggtggaagacttcatgtgtagctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100414261Help
Entry
100414261         CDS       T03264                                 

Gene name
E2F1
Definition
(RefSeq) E2F transcription factor 1
  KO
K17454  transcription factor E2F1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01522  Endocrine resistance
cjc04110  Cell cycle
cjc04137  Mitophagy - animal
cjc04218  Cellular senescence
cjc04934  Cushing syndrome
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05163  Human cytomegalovirus infection
cjc05165  Human papillomavirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05169  Epstein-Barr virus infection
cjc05200  Pathways in cancer
cjc05206  MicroRNAs in cancer
cjc05212  Pancreatic cancer
cjc05214  Glioma
cjc05215  Prostate cancer
cjc05218  Melanoma
cjc05219  Bladder cancer
cjc05220  Chronic myeloid leukemia
cjc05222  Small cell lung cancer
cjc05223  Non-small cell lung cancer
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Module
cjc_M00692  Cell cycle - G1/S transition
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100414261 (E2F1)
  09143 Cell growth and death
   04110 Cell cycle
    100414261 (E2F1)
   04218 Cellular senescence
    100414261 (E2F1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100414261 (E2F1)
   05206 MicroRNAs in cancer
    100414261 (E2F1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100414261 (E2F1)
   05225 Hepatocellular carcinoma
    100414261 (E2F1)
   05226 Gastric cancer
    100414261 (E2F1)
   05214 Glioma
    100414261 (E2F1)
   05220 Chronic myeloid leukemia
    100414261 (E2F1)
   05218 Melanoma
    100414261 (E2F1)
   05219 Bladder cancer
    100414261 (E2F1)
   05215 Prostate cancer
    100414261 (E2F1)
   05224 Breast cancer
    100414261 (E2F1)
   05222 Small cell lung cancer
    100414261 (E2F1)
   05223 Non-small cell lung cancer
    100414261 (E2F1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100414261 (E2F1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100414261 (E2F1)
   05161 Hepatitis B
    100414261 (E2F1)
   05160 Hepatitis C
    100414261 (E2F1)
   05163 Human cytomegalovirus infection
    100414261 (E2F1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100414261 (E2F1)
   05169 Epstein-Barr virus infection
    100414261 (E2F1)
   05165 Human papillomavirus infection
    100414261 (E2F1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100414261 (E2F1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100414261 (E2F1)
Transcription factors [BR:cjc03000]
 Eukaryotic Type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    100414261 (E2F1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E2F_CC-MB E2F_TDP
Motif
Other DBs
NCBI-GeneID: 100414261
NCBI-ProteinID: XP_017827322
Position
5
AA seq 439 aa AA seqDB search
MALAGAPAGGPCAPELETLLGXNTKRLLDSSQIVIIYAAQDASVPPAPAGPAAPAAGPCD
PDMLLFATPQAPRPTPSAPRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHQGKGVK
SPGEKSRYETSLNLTTKRFLELLSRSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLI
AKKSKNHIQWXGSHTTVGVGGRLEGLTQDLRQLQESEQQLDHLMNICTTQLRLLSEDTDS
QRLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAVDSSETFQISLKSKQGPIDVFLCPE
ETVGGISPGKTPSPSREAASVEENRASDSATIVPPPSSSPHSSFATDPSQSLLSLEQEPL
LSRMGSLRAPMDEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEGLDYHFGLEEG
EGIRDLFDCDFGDFTPLDF
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggctttggccggggcccctgcgggcggcccatgcgcgccggagctggaaaccctgctc
gggnaaaacacgaagcggctgctcgactcctcgcagatcgtcatcatctacgccgcacag
gacgccagcgtcccgccggccccagctggccccgcggcgcccgccgccggcccgtgcgac
cccgacatgctgctattcgccactccgcaggcgccccggcccacacccagcgcgccgcgc
cccgcgctcggccgcccgccggtgaagcggaggctggacctggaaactgaccatcagtac
ctggctgaaagcagtgggccagctcggggcagaggccgccatcaaggaaaaggtgtgaaa
tccccgggggagaagtcacgctatgagacctcactgaatctgaccaccaagcgcttcctg
gagctgctgagccgctctgctgacggtgttgtcgacctgaactgggctgccgaggtgctc
aaagtgcagaagcggcgcatctatgacatcaccaatgttctcgagggcatccagctcatt
gccaagaagtccaagaaccacatccagtgggngggcagccacaccacagtgggtgttggt
gggcggcttgaggggctgacccaggacctccggcagctgcaggagagtgagcagcagctg
gaccacctgatgaatatctgtactacgcagctgcgcctgctctccgaggacactgacagc
cagcgcctggcctatgtgacgtgccaggatcttcgtagcattgcagaccctgcagagcag
atggttatggtgatcaaggctcctcctgagacccagctccaagctgtggactcttcggag
acatttcagatctctcttaagagcaaacaaggccccatcgatgttttcctgtgccctgag
gagactgtgggtgggatcagccctgggaagaccccgtccccgtcccgggaggctgcttct
gtggaggagaacagggcctctgactctgccaccatagtgccgccaccatcatcatctccc
cactcatccttcgccacagatcccagccagtctctgctcagcctggagcaagaaccactg
ttgtcccggatgggcagcctacgggctcccatggacgaggaccgcctgtccccgctggtg
gcagccgactcgctcctggagcatgtgcgggaggacttctccggcctcctccctgaggag
ttcatcagcctttccccaccccatgagggcctcgactaccacttcggcctcgaggagggc
gagggcatcagagacctcttcgactgtgactttggggacttcacccccctcgatttctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100414776Help
Entry
100414776         CDS       T03264                                 

Gene name
E2F2
Definition
(RefSeq) E2F transcription factor 2
  KO
K09389  transcription factor E2F2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01522  Endocrine resistance
cjc04110  Cell cycle
cjc04218  Cellular senescence
cjc04934  Cushing syndrome
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05163  Human cytomegalovirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05169  Epstein-Barr virus infection
cjc05200  Pathways in cancer
cjc05206  MicroRNAs in cancer
cjc05212  Pancreatic cancer
cjc05214  Glioma
cjc05215  Prostate cancer
cjc05218  Melanoma
cjc05219  Bladder cancer
cjc05220  Chronic myeloid leukemia
cjc05222  Small cell lung cancer
cjc05223  Non-small cell lung cancer
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Module
cjc_M00692  Cell cycle - G1/S transition
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100414776 (E2F2)
   04218 Cellular senescence
    100414776 (E2F2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100414776 (E2F2)
   05206 MicroRNAs in cancer
    100414776 (E2F2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100414776 (E2F2)
   05225 Hepatocellular carcinoma
    100414776 (E2F2)
   05226 Gastric cancer
    100414776 (E2F2)
   05214 Glioma
    100414776 (E2F2)
   05220 Chronic myeloid leukemia
    100414776 (E2F2)
   05218 Melanoma
    100414776 (E2F2)
   05219 Bladder cancer
    100414776 (E2F2)
   05215 Prostate cancer
    100414776 (E2F2)
   05224 Breast cancer
    100414776 (E2F2)
   05222 Small cell lung cancer
    100414776 (E2F2)
   05223 Non-small cell lung cancer
    100414776 (E2F2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100414776 (E2F2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100414776 (E2F2)
   05161 Hepatitis B
    100414776 (E2F2)
   05160 Hepatitis C
    100414776 (E2F2)
   05163 Human cytomegalovirus infection
    100414776 (E2F2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100414776 (E2F2)
   05169 Epstein-Barr virus infection
    100414776 (E2F2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100414776 (E2F2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100414776 (E2F2)
Transcription factors [BR:cjc03000]
 Eukaryotic Type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    100414776 (E2F2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E2F_CC-MB E2F_TDP
Motif
Other DBs
NCBI-GeneID: 100414776
NCBI-ProteinID: XP_002750465
Ensembl: ENSCJAG00000020962
UniProt: F7IIE1
Position
7
AA seq 437 aa AA seqDB search
MLRGPRILASATGQHPKVVPAMSPTELWPPGLSSPQLCPATTTYYTPLYPQTAPPAAAPG
ICLDATPHGPEGQVVRCLPAGRLPAKRKLNLEGIGRPAVLEFPTPKGKCIRVDGLPSPKT
PKSPGEKTRYDTSLGLLTKKFIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQ
LIRKKAKNNIQWVGRGMFEDPTRPGKQQQLGQELKELMNREQALDQLIQSCSLSFKHLTE
DKANKRLAYVTYQDIRAVSNFKEQTVIAVKAPPQTRLEVPDRTEDNLQIYLKSTQGPIEV
YLCPEEVQEPDSPSEEPLPSTSTLSPSPDSAQPSSSTDPSIMEPTASSVPAPAPIPQQVP
LPPSLVPLEATDSMLELPHPLLQQTEDQFLSPTLACSSPLISFSPSLDQDDYLWGLEAGE
GISDLFDSYDLGDLLIN
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgagggccccggatcttggcttcggccactgggcagcacccgaaggtggtgccc
gcgatgagccccacggagctgtggccgcccggcctcagcagcccccagctctgcccagct
actaccacctactacacgccgttgtacccgcagacggcgcctcccgctgcggcgcccggc
atctgcctcgacgccactccccatggacccgagggccaagttgtgcgatgcctgccggca
ggccggctgccggccaaaaggaagctgaatctggaggggattgggaggcccgccgtcctt
gagttcccaacccccaaggggaagtgcatcagagtggatggcctccccagccccaaaacc
cccaaatcccctggggagaagactcgatatgacacctcgctggggctgctcaccaagaag
ttcatttaccttctgagcgagtccgaggatggggtcctggacctgaactgggccgctgag
gtgctggacgtgcagaagcggcgcatctatgacatcaccaatgtgctagagggcatccag
ctcatccgcaagaaggccaagaacaacatccagtgggtaggcaggggaatgtttgaagac
cccacccggcctgggaagcagcaacagctggggcaggagctgaaggagctgatgaacagg
gagcaggccctggaccagctcatccagagctgctctctgagcttcaagcacctgactgag
gacaaggccaacaagaggctggcctatgtgacttaccaggatatccgtgctgtcagcaac
tttaaggagcagacagtgattgccgtcaaggcccctccgcagacgagactggaagtgcct
gacaggactgaggacaacctgcagatatatctcaagagcacccaagggcccatcgaagtc
tacctgtgcccagaggaggtgcaggagcccgacagtccttccgaggagcccctcccttct
acctctaccctcagccctagccctgactctgcccagcccagcagcagcaccgaccctagc
atcatggagcccacagcatcctcagtgccagcgccagcaccgatcccccagcaggtccca
ctgcctccgtccctggtgcccttggaagctactgacagcatgctggagctgccacaccca
ctcctgcagcagaccgaggaccaattcctgtccccaaccctggcgtgcagctcccctctg
atcagcttctcaccgtccttggaccaggatgactacctgtggggcttggaggcgggtgag
ggcatcagtgacctcttcgactcctacgaccttggggacctgttgattaattga

DBGET integrated database retrieval system