KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100390258Help
Entry
100390258         CDS       T03264                                 

Gene name
IKBKG
Definition
(RefSeq) inhibitor of nuclear factor kappa B kinase subunit gamma
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01523  Antifolate resistance
cjc04010  MAPK signaling pathway
cjc04014  Ras signaling pathway
cjc04062  Chemokine signaling pathway
cjc04064  NF-kappa B signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04210  Apoptosis
cjc04380  Osteoclast differentiation
cjc04620  Toll-like receptor signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04622  RIG-I-like receptor signaling pathway
cjc04623  Cytosolic DNA-sensing pathway
cjc04625  C-type lectin receptor signaling pathway
cjc04657  IL-17 signaling pathway
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04660  T cell receptor signaling pathway
cjc04662  B cell receptor signaling pathway
cjc04668  TNF signaling pathway
cjc04920  Adipocytokine signaling pathway
cjc05142  Chagas disease (American trypanosomiasis)
cjc05145  Toxoplasmosis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05165  Human papillomavirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05203  Viral carcinogenesis
cjc05212  Pancreatic cancer
cjc05215  Prostate cancer
cjc05220  Chronic myeloid leukemia
cjc05221  Acute myeloid leukemia
cjc05222  Small cell lung cancer
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cjc05340  Primary immunodeficiency
cjc05418  Fluid shear stress and atherosclerosis
Module
cjc_M00686  Toll-like receptor signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100390258 (IKBKG)
   04010 MAPK signaling pathway
    100390258 (IKBKG)
   04064 NF-kappa B signaling pathway
    100390258 (IKBKG)
   04668 TNF signaling pathway
    100390258 (IKBKG)
   04151 PI3K-Akt signaling pathway
    100390258 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100390258 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100390258 (IKBKG)
   04621 NOD-like receptor signaling pathway
    100390258 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    100390258 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    100390258 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    100390258 (IKBKG)
   04660 T cell receptor signaling pathway
    100390258 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    100390258 (IKBKG)
   04659 Th17 cell differentiation
    100390258 (IKBKG)
   04657 IL-17 signaling pathway
    100390258 (IKBKG)
   04662 B cell receptor signaling pathway
    100390258 (IKBKG)
   04062 Chemokine signaling pathway
    100390258 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100390258 (IKBKG)
  09158 Development
   04380 Osteoclast differentiation
    100390258 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100390258 (IKBKG)
   05203 Viral carcinogenesis
    100390258 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100390258 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100390258 (IKBKG)
   05221 Acute myeloid leukemia
    100390258 (IKBKG)
   05220 Chronic myeloid leukemia
    100390258 (IKBKG)
   05215 Prostate cancer
    100390258 (IKBKG)
   05222 Small cell lung cancer
    100390258 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    100390258 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100390258 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100390258 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    100390258 (IKBKG)
   05162 Measles
    100390258 (IKBKG)
   05164 Influenza A
    100390258 (IKBKG)
   05161 Hepatitis B
    100390258 (IKBKG)
   05160 Hepatitis C
    100390258 (IKBKG)
   05168 Herpes simplex virus 1 infection
    100390258 (IKBKG)
   05163 Human cytomegalovirus infection
    100390258 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100390258 (IKBKG)
   05169 Epstein-Barr virus infection
    100390258 (IKBKG)
   05165 Human papillomavirus infection
    100390258 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100390258 (IKBKG)
   05142 Chagas disease (American trypanosomiasis)
    100390258 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100390258 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100390258 (IKBKG)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   100390258 (IKBKG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 zf_C2H2_ZHX LLC1 Bacillus_HBL
Motif
Other DBs
NCBI-GeneID: 100390258
NCBI-ProteinID: XP_008988364
Ensembl: ENSCJAG00000016764
UniProt: B0KWU0
Position
X
AA seq 419 aa AA seqDB search
MSRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKQAMLHLPSEQGAPETLQRCLEENQE
LRDAIRQSNQMLRERCEELLHFQASQREEKEFLMCKFQEARKLVERLSLEKLDLKRQKEQ
ALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQ
VRQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQE
YDNHIKSSVVSSERKRGMQLEDLKQQLQQAEEALVAKQELIDKLKEEAEQHKMVMETVPV
LKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRH
VEVSPTPLPPAPAHHSFLLAQPNQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgagcagacacctctggaagagccagctgtgtgagatggtgcagcccagtggcggcccg
gcagcagatcaggacgtgctgggcgaagagtctcctctggggaagcaggccatgttgcac
ctgccttcagagcagggtgctcctgagaccctccagcgctgcctggaggagaatcaagag
cttcgagatgccatccggcagagcaatcagatgctgcgggagcgctgtgaggagcttctg
catttccaagccagccagagggaagaaaaggagttcctcatgtgcaaattccaggaggcc
aggaaactagtggagagactcagcctggagaagctcgacctgaagaggcagaaggagcag
gccctgcgggaggtggagcacctgaagagatgccagcagcagatggctgaggacaaggcc
tctgtgaaagcccaggtgacgtcgttgctcggggagctccaggaaagccagagtcgcttg
gaggctgccactaaggaatgccaggctctggagggtcgggctcgggcggccagtgagcag
gtgcggcagctagagagcgagcgtgaggcgctgcagcagcagcacagtgtgcaggtggac
cagctgcgcatgcagggccagagtgtggaggctgcacttcgcatggagcgacaggccgcc
tcggaggagaagcggaagctggctcagttgcaggtggcctatcaccagctcttccaagaa
tacgacaaccacatcaagagcagtgtggtgagcagcgagcggaagcgaggaatgcagctg
gaagatctcaagcagcagctccagcaggctgaggaggccctggtggccaaacaggagctg
atcgataagctgaaggaggaggccgagcagcacaagatggtgatggagacggttccggtg
ctgaaggcgcaggcggacatctacaaggcggacttccaggctgaaaggcaggcccgggag
aagctggctgagaagaaggagctgttgcaggagcagctggagcagctgcagagggagtac
agcaaattgaaggccagctgtcaggagtcggccaggattgaggacatgaggaagcggcat
gtagaggtctctccgacccccttgccccctgcacccgcccaccactcctttctcctggct
cagcccaaccagaggaggagcccccctgaggagccacctgacttctgctgtcccaagtgc
cagtatcaggcccctgatatggacaccctgcagatacacgtcatggagtgcattgagtag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100393096Help
Entry
100393096         CDS       T03264                                 

Gene name
IKBKB
Definition
(RefSeq) inhibitor of nuclear factor kappa B kinase subunit beta
  KO
K07209  inhibitor of nuclear factor kappa-B kinase subunit beta [EC:2.7.11.10]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01523  Antifolate resistance
cjc04010  MAPK signaling pathway
cjc04014  Ras signaling pathway
cjc04062  Chemokine signaling pathway
cjc04064  NF-kappa B signaling pathway
cjc04068  FoxO signaling pathway
cjc04150  mTOR signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04210  Apoptosis
cjc04380  Osteoclast differentiation
cjc04620  Toll-like receptor signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04622  RIG-I-like receptor signaling pathway
cjc04623  Cytosolic DNA-sensing pathway
cjc04625  C-type lectin receptor signaling pathway
cjc04657  IL-17 signaling pathway
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04660  T cell receptor signaling pathway
cjc04662  B cell receptor signaling pathway
cjc04668  TNF signaling pathway
cjc04722  Neurotrophin signaling pathway
cjc04910  Insulin signaling pathway
cjc04920  Adipocytokine signaling pathway
cjc04930  Type II diabetes mellitus
cjc04931  Insulin resistance
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc05142  Chagas disease (American trypanosomiasis)
cjc05145  Toxoplasmosis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05165  Human papillomavirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05206  MicroRNAs in cancer
cjc05212  Pancreatic cancer
cjc05215  Prostate cancer
cjc05220  Chronic myeloid leukemia
cjc05221  Acute myeloid leukemia
cjc05222  Small cell lung cancer
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cjc05418  Fluid shear stress and atherosclerosis
Module
cjc_M00686  Toll-like receptor signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100393096 (IKBKB)
   04010 MAPK signaling pathway
    100393096 (IKBKB)
   04064 NF-kappa B signaling pathway
    100393096 (IKBKB)
   04668 TNF signaling pathway
    100393096 (IKBKB)
   04068 FoxO signaling pathway
    100393096 (IKBKB)
   04151 PI3K-Akt signaling pathway
    100393096 (IKBKB)
   04150 mTOR signaling pathway
    100393096 (IKBKB)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100393096 (IKBKB)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100393096 (IKBKB)
   04621 NOD-like receptor signaling pathway
    100393096 (IKBKB)
   04622 RIG-I-like receptor signaling pathway
    100393096 (IKBKB)
   04623 Cytosolic DNA-sensing pathway
    100393096 (IKBKB)
   04625 C-type lectin receptor signaling pathway
    100393096 (IKBKB)
   04660 T cell receptor signaling pathway
    100393096 (IKBKB)
   04658 Th1 and Th2 cell differentiation
    100393096 (IKBKB)
   04659 Th17 cell differentiation
    100393096 (IKBKB)
   04657 IL-17 signaling pathway
    100393096 (IKBKB)
   04662 B cell receptor signaling pathway
    100393096 (IKBKB)
   04062 Chemokine signaling pathway
    100393096 (IKBKB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100393096 (IKBKB)
   04920 Adipocytokine signaling pathway
    100393096 (IKBKB)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100393096 (IKBKB)
  09158 Development
   04380 Osteoclast differentiation
    100393096 (IKBKB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100393096 (IKBKB)
   05206 MicroRNAs in cancer
    100393096 (IKBKB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100393096 (IKBKB)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100393096 (IKBKB)
   05221 Acute myeloid leukemia
    100393096 (IKBKB)
   05220 Chronic myeloid leukemia
    100393096 (IKBKB)
   05215 Prostate cancer
    100393096 (IKBKB)
   05222 Small cell lung cancer
    100393096 (IKBKB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100393096 (IKBKB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100393096 (IKBKB)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100393096 (IKBKB)
   04931 Insulin resistance
    100393096 (IKBKB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100393096 (IKBKB)
   05170 Human immunodeficiency virus 1 infection
    100393096 (IKBKB)
   05162 Measles
    100393096 (IKBKB)
   05164 Influenza A
    100393096 (IKBKB)
   05161 Hepatitis B
    100393096 (IKBKB)
   05160 Hepatitis C
    100393096 (IKBKB)
   05168 Herpes simplex virus 1 infection
    100393096 (IKBKB)
   05163 Human cytomegalovirus infection
    100393096 (IKBKB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100393096 (IKBKB)
   05169 Epstein-Barr virus infection
    100393096 (IKBKB)
   05165 Human papillomavirus infection
    100393096 (IKBKB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100393096 (IKBKB)
   05142 Chagas disease (American trypanosomiasis)
    100393096 (IKBKB)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100393096 (IKBKB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100393096 (IKBKB)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     100393096 (IKBKB)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   100393096 (IKBKB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IKBKB_SDD Pkinase Pkinase_Tyr IKKbetaNEMObind Pkinase_fungal Kdo ubiquitin APH YrbL-PhoP_reg Med20 Glyco_hydro_65m
Motif
Other DBs
NCBI-GeneID: 100393096
NCBI-ProteinID: XP_002757049
Ensembl: ENSCJAG00000007805
UniProt: F7I235
Position
13
AA seq 756 aa AA seqDB search
MSWSPSLTTQTCGTWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRDRWCL
EIQIMRRLSHPNVVAAREVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREG
AILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQSSLCT
SFVGTLQYLAPELLEQLKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHSKVRQKSE
MDIVVSEDLNGTVKFSSSLPYPNNLNSVLAKRLEKWLQLMLMWHPRQRGTDPTYGPNGCF
KALDDILNSKLVHILNMVTGTIHTYPVTEDESLQSLKARIQQDTGIPEEDQELLQEAGLA
LIPDKPATQCISDSKLNEGRTLDMDLVFLFDNSKVTYETQISPRPQPESVSYILQEPKRN
LAFFQLRKVWGQVWHSIQTLKEDCNRLQQGQRAAMMNLLRNNSCLSKMKNSMASMSQQLK
AKLDFFKTSIQIDLEKYNEQTEFGITSDKLLLAWREMEQAVERCGRENEVKLLVERMMAL
QTDIVDLQRSPMGRKQGGTLDDLEEQARELYRRLREKPRDQRTEGDSQEMVRLLLQAIQS
FEKKVRVIYTQLSKTVVCKQKALELLPKVEEVMSLMNEDEKTVVRLQEKRQKELWNLLKI
ACSKVRGPVSGSPDSMNASRLSQPGQLMSQPSTTSDSLPETAKKSEELVAEAQNLCILLE
NAIQDTVREQDQSFMALDWSWLQTEEEEHSCLEQAS
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atgagctggtcaccttccctgacaacccagacgtgtgggacctgggaaatgaaagagcgc
cttgggacagggggatttggaaatgtcatccgatggcacaatcaggaaacaggtgagcag
atcgccatcaagcagtgccggcaggagctcagcccacggaaccgagaccggtggtgcctg
gagatccagatcatgagaaggctgagccaccccaatgtggtggctgctcgggaggtccct
gaggggatgcagaacttggcgcccaatgacctacccctgctggccatggagtactgccaa
ggaggagatctccggaagtacctgaaccagtttgagaactgctgtggcctgcgggaagga
gccatcctcaccttgctgagtgacattgcctctgcacttaggtaccttcatgaaaacaga
atcatccatcgggatctaaagccagaaaacatcgtcctgcagcaaggagaacagaggtta
atacacaaaattattgacctaggatatgccaaagagctggatcagagcagtctttgcacg
tcgtttgtggggaccctgcagtacctggccccagagctgctggagcagctgaagtacacg
gtgactgtcgactactggagcttcggcaccctggctttcgagtgcatcacgggcttccgg
cccttcctccccaactggcagcccgtgcagtggcattcgaaagtccggcagaagagtgag
atggacattgttgtcagtgaagacttgaatggaacagtgaagttttcaagttctttacct
taccccaataatcttaacagtgtcctggctaagcgactggagaagtggctgcagctgatg
ctgatgtggcacccccggcagaggggcacggatcccacgtatgggcccaatggctgtttc
aaggccctggatgacatcttaaactcaaagctggttcatatcttgaacatggtcacaggc
accatccacacctatcctgtgacagaggacgagagtctgcagagcttgaaggccagaatc
cagcaggacacaggcatcccagaggaggaccaggagctgctgcaggaagcgggcctggca
ttgatccctgacaagcctgccactcagtgtatttcagacagcaagttaaatgagggccgc
acattggacatggatcttgtttttctcttcgacaacagtaaagtcacctatgagactcag
atctccccacggccccaacctgaaagtgtcagctatatccttcaagagcccaagaggaac
cttgccttctttcagctgaggaaggtgtggggccaggtctggcacagcatccagaccctg
aaggaggattgcaaccggctgcagcagggacagcgagctgccatgatgaatctcctccgg
aacaacagctgtctctccaagatgaagaattccatggcttccatgtctcagcagctcaag
gccaagttggatttcttcaaaaccagcatccagattgacctggagaagtacaacgagcaa
accgagtttggcatcacatcagataaactgctgctggcttggagggaaatggagcaggct
gtggagcgctgtgggcgggagaatgaagtgaaactcctggtggagcggatgatggcgctg
cagaccgacattgtggacttgcagaggagccccatgggccggaagcagggggggacactg
gatgacctagaggagcaagcaagggagctctacaggagactaagagaaaagccacgagac
cagcgaactgagggtgacagtcaggaaatggtgcggctgctgcttcaggcaattcagagc
tttgagaagaaagtgcgagtgatctatacacagctcagtaaaactgtggtttgcaagcag
aaggcactggaactgctgcccaaggtggaagaggtgatgagcttgatgaatgaggatgag
aagactgttgtccggctgcaggagaagcggcagaaggagctctggaatctcctgaagatc
gcttgtagcaaggtccgtggtcccgtcagtggaagccctgatagcatgaatgcctctcga
cttagccagcctgggcagctgatgtctcagccttccacgacctctgacagcttacccgag
acagccaagaagagtgaagaactggtggctgaagcacagaacctctgcatcctgctagaa
aatgccatacaggacaccgtgagggagcaagaccagagttttatggccctagactggagc
tggttacaaacagaagaagaagagcacagctgcctggagcaggcctcgtga

DBGET integrated database retrieval system