KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100390337Help
Entry
100390337         CDS       T03264                                 

Gene name
SHC1
Definition
(RefSeq) SHC adaptor protein 1
  KO
K06279  SHC-transforming protein 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc01522  Endocrine resistance
cjc04012  ErbB signaling pathway
cjc04014  Ras signaling pathway
cjc04062  Chemokine signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04510  Focal adhesion
cjc04650  Natural killer cell mediated cytotoxicity
cjc04722  Neurotrophin signaling pathway
cjc04910  Insulin signaling pathway
cjc04915  Estrogen signaling pathway
cjc04917  Prolactin signaling pathway
cjc04926  Relaxin signaling pathway
cjc05034  Alcoholism
cjc05100  Bacterial invasion of epithelial cells
cjc05206  MicroRNAs in cancer
cjc05214  Glioma
cjc05220  Chronic myeloid leukemia
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100390337 (SHC1)
   04012 ErbB signaling pathway
    100390337 (SHC1)
   04072 Phospholipase D signaling pathway
    100390337 (SHC1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100390337 (SHC1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100390337 (SHC1)
   04062 Chemokine signaling pathway
    100390337 (SHC1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100390337 (SHC1)
   04915 Estrogen signaling pathway
    100390337 (SHC1)
   04917 Prolactin signaling pathway
    100390337 (SHC1)
   04926 Relaxin signaling pathway
    100390337 (SHC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100390337 (SHC1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100390337 (SHC1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100390337 (SHC1)
   05226 Gastric cancer
    100390337 (SHC1)
   05214 Glioma
    100390337 (SHC1)
   05220 Chronic myeloid leukemia
    100390337 (SHC1)
   05224 Breast cancer
    100390337 (SHC1)
  09165 Substance dependence
   05034 Alcoholism
    100390337 (SHC1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100390337 (SHC1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100390337 (SHC1)
   01522 Endocrine resistance
    100390337 (SHC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PID SH2 Delta_lysin
Motif
Other DBs
NCBI-GeneID: 100390337
NCBI-ProteinID: XP_002760103
Ensembl: ENSCJAG00000009236
Position
18
AA seq 576 aa AA seqDB search
MDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELPSPSASSLGPILPPLPGDDSPTTLCS
FFPRMSNLRLANPAGGRPGPKGEPGRAADDGEGIVGAAMPDSGPLPLLQDMNKLSGGGGR
RTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVCYLVRYMGCVEVLQSMRALD
FNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTISTSS
LNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDV
ISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEEEPPDHQYYNDFPGKEPPL
GGVVDMRLREGATPPTAQTPSHLGATLPIGQPVGGDPEVRKQMPLPPPCPGRELFDDPSY
VNVQNLDKARQAGGGAGPPNPAINGSAPRDLFDMKPFEDALRVPPPPQSVTMAEQLRGEP
WFHGKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPEGVVRTKDH
RFESVSHLISYHMDNHLPIISAGSELCLQQPVERKL
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atggatctcctgccccctaagcccaagtacaatccactccggaatgagtctctgtcatcg
ctggaggagggggcttcagggtccacccccccggaggagctgccttccccatcagcctca
tccctgggacccatcctgcctcctctgcctggggacgatagtcccactaccctgtgctcc
ttcttcccgcggatgagcaacctgaggctcgccaatccggctggggggcgccccgggcct
aagggggagccaggaagggcagccgatgatggggaggggatcgtaggggcagccatgcca
gactcaggccccctacccctcctccaggacatgaacaagctgagtggaggcggcgggcgc
aggactcgggtggaagggggccagctggggggcgaggagtggacccgccacgggagcttt
gtcaataagcccacacggggctggctgcatcccaacgacaaagtcatgggacccggggtt
tgctacttggttcggtacatgggctgtgtggaggtcctgcagtcaatgcgtgccctggac
ttcaacacccggactcaggtcaccagggaggccatcagtctggtgtgtgaggctgtgccg
ggtgctaagggggcgacaaggaggagaaagccctgtagccgcccgctcagctctatcctg
ggaaggagtaacctgaaatttgctgggatgccaatcactctcaccatctccaccagcagc
ctcaacctcatggccgcagactgcaagcagatcatcgccaaccaccacatgcaatctatc
tcatttgcatccggcggggatccggacacagccgagtatgtcgcctatgttgccaaagac
cctgtgaatcagagagcctgccacattctggagtgtcctgaagggcttgcccaggatgtc
atcagcaccattggtcaggccttcgagttgcgcttcaaacaatacctcaggaacccaccc
aaactggtcaccccccatgacaggatggctggctttgatggctcagcttgggatgaggag
gaggaagagccacctgaccatcagtactataatgacttcccggggaaggaaccccctctt
gggggggtagtagacatgaggcttcgggaaggagccactccgcccactgcccagaccccc
agccacttgggagctacactgcctataggacagcctgttggaggagatccagaagtccgc
aaacagatgccacttccaccaccctgtccaggcagagagctctttgatgatccctcctac
gtcaacgtccagaacctagacaaggcccggcaagcagggggtggtgctgggccccccaat
cctgccatcaatggcagtgcgccccgggacctatttgacatgaagccctttgaagatgct
cttcgggtgcctccacctccccagtcggtcaccatggctgagcagctccgaggggagccc
tggttccatgggaagctgagccggcgggaggctgaggcactgctgcagctcaacggggac
ttcctggtgcgggagagcacgaccacacctggccagtatgtgctcactggcttgcagagt
gggcagcccaagcatctgctactggtggaccctgagggtgtggttcggacaaaggatcac
cgctttgagagtgtcagtcacctcatcagctaccacatggacaatcacttgcccatcatc
tctgcgggcagcgaactgtgtctacagcaacctgtggagcggaaactgtga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100392220Help
Entry
100392220         CDS       T03264                                 

Gene name
SHC4
Definition
(RefSeq) SHC adaptor protein 4
  KO
K17449  SHC-transforming protein 4
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc01522  Endocrine resistance
cjc04012  ErbB signaling pathway
cjc04014  Ras signaling pathway
cjc04062  Chemokine signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04510  Focal adhesion
cjc04650  Natural killer cell mediated cytotoxicity
cjc04722  Neurotrophin signaling pathway
cjc04910  Insulin signaling pathway
cjc04915  Estrogen signaling pathway
cjc04917  Prolactin signaling pathway
cjc04926  Relaxin signaling pathway
cjc05034  Alcoholism
cjc05100  Bacterial invasion of epithelial cells
cjc05206  MicroRNAs in cancer
cjc05214  Glioma
cjc05220  Chronic myeloid leukemia
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100392220 (SHC4)
   04012 ErbB signaling pathway
    100392220 (SHC4)
   04072 Phospholipase D signaling pathway
    100392220 (SHC4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100392220 (SHC4)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100392220 (SHC4)
   04062 Chemokine signaling pathway
    100392220 (SHC4)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100392220 (SHC4)
   04915 Estrogen signaling pathway
    100392220 (SHC4)
   04917 Prolactin signaling pathway
    100392220 (SHC4)
   04926 Relaxin signaling pathway
    100392220 (SHC4)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100392220 (SHC4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100392220 (SHC4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100392220 (SHC4)
   05226 Gastric cancer
    100392220 (SHC4)
   05214 Glioma
    100392220 (SHC4)
   05220 Chronic myeloid leukemia
    100392220 (SHC4)
   05224 Breast cancer
    100392220 (SHC4)
  09165 Substance dependence
   05034 Alcoholism
    100392220 (SHC4)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100392220 (SHC4)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100392220 (SHC4)
   01522 Endocrine resistance
    100392220 (SHC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PID SH2 Delta_lysin
Motif
Other DBs
NCBI-GeneID: 100392220
NCBI-ProteinID: XP_002807237
Ensembl: ENSCJAG00000001673
Position
10
AA seq 627 aa AA seqDB search
MRERGQDSLAGLVLYVGLFGHPGMLHRAKYSRFRNESITSLDEGSPGGSVGNKGSPQPPH
PTLSPHLPAEDATLPSQESPTPLCTLIPRMASMKLANPATLLSLXNFCLGTKEVPRLKLH
ESRDPGSSSSSSPETSLSGSGTAPPPQPDLVGHRATALTPDSCPLPRPREPPLRSRQDRH
FLPHLLGMGMNYCVRYMGCIEVLQSMRSLDFGMRTQVTREAISRLCEAVPGANGAIKKRK
PPVKFLSTVLGKSNLQFSGTNIKLTISTCSLTLMNLDNQQIIANHHMQSISFASGGDPDT
TDYVAYVAKDPVNQRACHILECQNGMAQDVISTIGQAFELRFKQYLKNPSLNTSCESEEV
RIASHAEDREDHQYYNEIPGKQPPVGGVSDVRIRVQATEQMAYCPIRCEKLCYLPGNSKC
SSVYENCIEQSRGLGNVHPRGVQSQRDTSLLKHTCRVDLFDDPCYINTQALQSTLGSAGN
QTHPLGSPWHCGKAPETVQPGAVAQPASSHSLPHIKQQLWSEECYHGKLSRKAAESLLVK
DGDFLVRESATSPGQYVLSGLQGGQAKHLLLVDPEGKVRTKDHVFDNVGHLIRYHMDNSL
PIISSGSEVSLKQPVRKDNPGLLHSNK
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgcgagaacgcggccaggacagcctggcaggactcgtgctgtatgtaggactcttcggg
caccccgggatgctgcacagggccaagtacagccgctttcggaacgagtcgatcacgtcc
ttggacgaaggtagccccggaggctcggtcgggaacaagggctcgccgcagcctccccac
cccaccctgtcacctcacctgccagctgaagatgccaccttgccatcgcaggagagcccc
accccactgtgcaccttgatcccccgcatggcgagcatgaagctggccaacccggccact
ttgctgagtctgnaaaacttttgcctgggtaccaaagaggtgcctcggctgaagctccat
gaaagccgggacccaggttccagcagctcatcatccccagaaaccagtctaagtgggtct
gggactgcacctccaccgcagccggacctggtgggccacagggcaaccgccttaacccct
gattcgtgcccacttcctcgccctagggagccacctcttaggagcaggcaggacagacac
tttctaccgcacctgttggggatgggcatgaactactgtgtgaggtacatgggctgtatt
gaagtgctgcaatcaatgaggtctctggattttggaatgagaacccaagttacaagggaa
gcaataagtcgcctgtgtgaagctgttcccggggcaaatggagccattaaaaagcgaaag
cctccagttaagttcctatcaacagttctcggcaaaagtaatcttcagttttcaggaacg
aatataaaactgaccatctcaacatgcagtctcacactgatgaaccttgacaaccaacag
attattgcaaatcatcatatgcagtctatttcatttgcctctggaggagatcctgatact
acagactacgttgcctatgtagctaaagatccagttaatcaaagagcctgtcacatattg
gaatgccaaaatggaatggcccaagatgtcataagtaccatagggcaggcttttgaactc
cggtttaaacagtacttgaaaaatccttctttgaatacttcttgtgaaagtgaggaggtg
cgtattgctagccatgccgaggacagagaagatcatcaatattataatgaaattccaggg
aagcagccaccggtaggtggtgtttcagatgtacggatcagagttcaagccacggaacaa
atggcttactgccccatacggtgtgaaaagttgtgctatttgcctggaaactccaagtgc
agcagtgtatatgagaactgtatagaacaaagcaggggactaggtaatgtccatccaaga
ggggtacagtcccagcgagatacctcattattgaagcacacatgccgagtggatctcttc
gacgacccctgctacattaatacacaggctcttcaaagtacacttggctctgctggaaat
caaacccacccactggggagcccgtggcactgtggaaaggcaccagaaactgttcagcca
ggtgctgtggcccagcctgccagctcacattctttgccacacattaagcagcagctgtgg
agtgaagaatgctaccatggcaagctgagcaggaaggcagcagagagcctcttggtaaag
gatggggactttttggttcgagagagtgcaacatcccctggccaatatgtgctgagtgga
ctacagggaggccaagcaaaacatcttctcctggtggatcctgaaggcaaggtgaggacc
aaggatcacgtgtttgataatgttggccaccttatcagataccatatggataacagtttg
ccaatcatctcttctggaagcgaagtaagccttaaacaaccagtgagaaaagataatcca
ggacttttgcattccaacaaatga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100402406Help
Entry
100402406         CDS       T03264                                 

Gene name
SHC3
Definition
(RefSeq) SHC adaptor protein 3
  KO
K17448  SHC-transforming protein 3
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc01522  Endocrine resistance
cjc04012  ErbB signaling pathway
cjc04014  Ras signaling pathway
cjc04062  Chemokine signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04510  Focal adhesion
cjc04650  Natural killer cell mediated cytotoxicity
cjc04722  Neurotrophin signaling pathway
cjc04910  Insulin signaling pathway
cjc04915  Estrogen signaling pathway
cjc04917  Prolactin signaling pathway
cjc04926  Relaxin signaling pathway
cjc05034  Alcoholism
cjc05100  Bacterial invasion of epithelial cells
cjc05214  Glioma
cjc05220  Chronic myeloid leukemia
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100402406 (SHC3)
   04012 ErbB signaling pathway
    100402406 (SHC3)
   04072 Phospholipase D signaling pathway
    100402406 (SHC3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100402406 (SHC3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100402406 (SHC3)
   04062 Chemokine signaling pathway
    100402406 (SHC3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100402406 (SHC3)
   04915 Estrogen signaling pathway
    100402406 (SHC3)
   04917 Prolactin signaling pathway
    100402406 (SHC3)
   04926 Relaxin signaling pathway
    100402406 (SHC3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100402406 (SHC3)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100402406 (SHC3)
   05226 Gastric cancer
    100402406 (SHC3)
   05214 Glioma
    100402406 (SHC3)
   05220 Chronic myeloid leukemia
    100402406 (SHC3)
   05224 Breast cancer
    100402406 (SHC3)
  09165 Substance dependence
   05034 Alcoholism
    100402406 (SHC3)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100402406 (SHC3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100402406 (SHC3)
   01522 Endocrine resistance
    100402406 (SHC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PID SH2
Motif
Other DBs
NCBI-GeneID: 100402406
NCBI-ProteinID: XP_008991027
Ensembl: ENSCJAG00000011207
UniProt: F7CZS2
Position
1
AA seq 598 aa AA seqDB search
MLPRTKYNRFRNDSVTSVDDLLHSLSVSGGGGKVSAARSTPAAAPYLVSGEALRKAPDDG
PGSLGHLLHKVSHLKLSSSGLRGLSSAARERAGARLSGSCSAPSLAAPDGSAPPAPRAPA
MNAARKGRPGDEPLPRPPRGAPHASDQVLGPGVTYVVKYLGCIEVLRSMRSLDFSTRTQI
TREAISRVCEAVPGAKGAFKKRKPPSKMLSSILGKSNLQFAGMSISLTISTASLNLRTPD
SKQIIANHHMRSISFASGGDPDTTDYVAYVAKDPVNRRACHILECCDGLAQDVIGSIGQA
FELRFKQYLQCPTKIPALHDRMQSLDEPWTEEEGDGSDHPYYNSIPSKMPPPGGFLDARL
KPRPHASDTAQFAGKEQTYYQGRHLGDTFGEDWQQTPFRQSERQGSLDIYSMPEGKLHMA
PTGEAPTYVNTQQIPPQAWPAVVSSAESSPRKDLFDMKPFEDALKNQPLGPMLSKAASVE
CISPVSPRAPDAKMLEELRAETWYQGEMSRKEAEGLLEKDGDFLVRKSTTNPGSFVLTGM
HNGQAKHLLLVDPEGTIRTKDRVFDSISHLINHHLESSLPIVSAGSELCLQQPVERKQ
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgcttccacgcaccaagtacaaccgcttcaggaatgactcggtgacatcggtcgatgac
cttctccacagtctgtcggtgagcggcggcggaggcaaggtctcggcggcgcgctcgacc
ccggctgcggctccctacttggtgtccggcgaggcgctgcgcaaggcgcccgacgatggg
cccggcagcctgggccacctgctccacaaggtgtcccacctgaaactctccagctccggc
ctccgcggcctgtcgtcggccgcccgggagcgggcgggcgcgcggctctccggcagctgc
agcgcgcccagcctggctgccccggacggcagtgcgcccccggcgccccgcgccccggcc
atgaacgccgccaggaaaggccggccaggcgacgagccgctgcccaggccccctcggggg
gcgccgcacgccagcgaccaggtgctggggcccggagtcacctacgtggtcaagtacctg
gggtgcattgaagttctgcgctcaatgaggtctcttgacttcagtacaagaacacaaatt
accagggaagccatcagccgtgtctgtgaagctgtgcctggtgccaagggagccttcaag
aagagaaagcctccaagcaaaatgctgtccagcatcttgggaaagagcaacctccagttt
gcgggaatgagcatctctctgaccatctccactgccagtctgaacctgcgaactccagac
tccaaacagatcatagcgaatcaccacatgcggtccatctccttcgcctctggaggagac
ccggacacaactgattatgttgcatatgtggctaaggaccctgttaatcgcagagcttgt
cacattttggaatgctgcgatgggctggcccaggatgtcattggctccataggacaagcc
ttcgagctccggtttaagcagtatttgcagtgtcctaccaagattcccgctctccatgac
cgaatgcagagtctggatgagccatggacggaagaggagggagatggctcagaccacccg
tattacaacagcatcccaagcaagatgcctcctccagggggctttcttgatgctcggctg
aaacccagaccccatgcttctgacacagcccagtttgcaggaaaagagcagacttattac
cagggaagacacttaggagacacctttggcgaagactggcagcaaacgcctttcaggcaa
agtgagaggcaagggtccttggacatctacagcatgccagaagggaaactgcacatggcc
cccacgggagaagcacccacctacgtcaacacccagcagatcccaccgcaggcctggcca
gctgtggtcagcagtgctgagagcagcccgaggaaagacctctttgacatgaaacctttt
gaagatgctctcaagaaccagccgttgggtcccatgttaagcaaggcagcctccgtggag
tgcatcagccctgtgtcacccagagccccggatgccaagatgctggaggagctgcgagct
gagacttggtaccaaggagagatgagcaggaaggaggcagaggggctgctggagaaagac
ggagacttcctggtcaggaagagcaccactaacccaggctccttcgtcctcacgggcatg
cacaatggccaggccaagcacctgctactcgtggacccggaaggcacgatccggacaaag
gacagagtctttgacagtatcagccacctcatcaaccaccacctagagagcagcctgccc
atcgtctctgcagggagcgagctgtgcctccagcagccagtggagaggaagcagtga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100415083Help
Entry
100415083         CDS       T03264                                 

Gene name
SHC2
Definition
(RefSeq) SHC adaptor protein 2
  KO
K17447  SHC-transforming protein 2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc01522  Endocrine resistance
cjc04012  ErbB signaling pathway
cjc04014  Ras signaling pathway
cjc04062  Chemokine signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04370  VEGF signaling pathway
cjc04510  Focal adhesion
cjc04650  Natural killer cell mediated cytotoxicity
cjc04722  Neurotrophin signaling pathway
cjc04910  Insulin signaling pathway
cjc04915  Estrogen signaling pathway
cjc04917  Prolactin signaling pathway
cjc04926  Relaxin signaling pathway
cjc05034  Alcoholism
cjc05100  Bacterial invasion of epithelial cells
cjc05214  Glioma
cjc05220  Chronic myeloid leukemia
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100415083 (SHC2)
   04012 ErbB signaling pathway
    100415083 (SHC2)
   04370 VEGF signaling pathway
    100415083 (SHC2)
   04072 Phospholipase D signaling pathway
    100415083 (SHC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100415083 (SHC2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100415083 (SHC2)
   04062 Chemokine signaling pathway
    100415083 (SHC2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100415083 (SHC2)
   04915 Estrogen signaling pathway
    100415083 (SHC2)
   04917 Prolactin signaling pathway
    100415083 (SHC2)
   04926 Relaxin signaling pathway
    100415083 (SHC2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100415083 (SHC2)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100415083 (SHC2)
   05226 Gastric cancer
    100415083 (SHC2)
   05214 Glioma
    100415083 (SHC2)
   05220 Chronic myeloid leukemia
    100415083 (SHC2)
   05224 Breast cancer
    100415083 (SHC2)
  09165 Substance dependence
   05034 Alcoholism
    100415083 (SHC2)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100415083 (SHC2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100415083 (SHC2)
   01522 Endocrine resistance
    100415083 (SHC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PID SH2
Motif
Other DBs
NCBI-GeneID: 100415083
NCBI-ProteinID: XP_017823609
Ensembl: ENSCJAG00000012832
Position
22
AA seq 423 aa AA seqDB search
MGCIEVLRSMRSLDFSTRTQVTREAINRLHEAVPGVRGSWKRKAPNKALASVLGKSNLRF
AGMSISIHISTDGLSLSVPATRQVIATHHMPSISFASGGDTATXPHDPAACHILECCEGL
AQSVISTVGQAFELRFKQYLHSPPKVALPPERLAGLEESAWGDEEEAAEHNYYNSIPGKE
PPPGGLVDSRLALTQPCALATLGQGPSPARRDARSLPWDMGHTGAAPPGDGYVQADARGP
PDPEEHLYVNTQGLDAPEPDDTAPLQPKDSPKKDLFDMRPFEDALKLHECSVATGTAAPL
PLEDQWPSPPTRRAPVAPTEEQLRQEPWYHGRMSRRAAERLLRADGDFLVRDSITNPGQY
VLTGMHAGRPKHLLLVDPEGAVRTKDVLFESISHLIDHHLQNGQPIVAAESELHLRGVVS
REP
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgggctgcatcgaggtcctccgctccatgcgctccctggacttcagtacgcgcacccag
gtgaccagggaagccatcaaccgtctccatgaggctgtgcctggcgtccggggatcctgg
aagagaaaggcccccaacaaggcgctggcatccgtcctgggcaagagcaaccttcgattt
gccggcatgagcatctccatccacatctccactgacggtctcagcctctctgtgcctgcc
acgcgccaggtcatcgccacccaccacatgccatccatctccttcgcatcaggcggagac
acggccacctgaccgcatgaccccgcagcctgccacatcctggagtgctgcgagggcctg
gcgcagagtgtcatcagtaccgtgggccaagcttttgagctgcgcttcaagcagtaccta
cacagcccgcctaaggtggccctgcccccggaaaggctggcgggactggaggagtcggcc
tggggggacgaggaggaagccgcggagcacaattactacaacagcattcctgggaaggag
ccgccgccgggcgggctggtggattccaggctggcactgacacagccctgcgcccttgcc
accctcggccagggcccatctcctgctcgaagagacgcccgcagcttgccgtgggacatg
gggcacacgggtgcagctccgccgggggacggctatgtgcaggcggacgcccggggcccc
ccggaccccgaggagcacctgtacgtcaacacccagggtctggacgcccctgagccggac
gacacggcgcccctgcagcccaaggacagccccaagaaggatctgtttgatatgcgaccc
tttgaggatgccttgaagctgcatgagtgctcagtggccacgggtacagcagcccccctt
cccttggaggaccagtggcccagccccccaacccgccgggccccagtggcccctacagag
gagcagctgcggcaggagccctggtaccacggccggatgagccgccgggcggcagagagg
ctgcttcgtgcggacggggacttcctggtgcgggacagcatcaccaaccccgggcagtat
gtcctcactggcatgcacgcggggcggcccaagcacctgctgctggtggaccctgagggc
gcggtgcggacgaaggacgtgctgtttgagagcatcagccacctgatcgaccaccacctg
cagaacgggcagcccatcgtggcggcggaaagcgagctgcacctgcgcggcgtggtctcc
cgggagccctga

DBGET integrated database retrieval system