KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100390356Help
Entry
100390356         CDS       T03264                                 

Gene name
REV3L
Definition
(RefSeq) REV3 like, DNA directed polymerase zeta catalytic subunit
  KO
K02350  DNA polymerase zeta [EC:2.7.7.7]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01524  Platinum drug resistance
cjc03460  Fanconi anemia pathway
Module
cjc_M00293  DNA polymerase zeta complex
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    100390356 (REV3L)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100390356 (REV3L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cjc03400]
    100390356 (REV3L)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     100390356 (REV3L)
DNA repair and recombination proteins [BR:cjc03400]
 Eukaryotic Type
  TLS (translesion DNA synthesis) factors
   B-family DNA polymerases
    100390356 (REV3L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4683 DNA_pol_B DNA_pol_B_exo1 zf-C4pol
Motif
Other DBs
NCBI-GeneID: 100390356
NCBI-ProteinID: XP_017826813
Ensembl: ENSCJAG00000005032
Position
4
AA seq 3129 aa AA seqDB search
MFSVRIVTADYYMASPLQGLDTCQSPLTQTPVKKVPVVRVFGATPAGQKTCLHLHGIFPY
LYVPYDGYGQQPESYLSQMAFSIDRALNVALGNPSSTAQHVFKVSLVSGMPFYGYHEKER
HFMKIYLYNPAMVKRICELLQSGAIMNKFYQPHEAHIPYLLQLFIDYNLYGMNLINLAAV
KFRKARRKSDTLHATGSCKNHLSGNSLAGTLFRWEQDEIPSSLLLEGVEPQSTCELEVDA
VAADILNRLDIEAQIGGNPGLQAIWEDEKQRRRNRNETSQISQPESQDHRFVPATESEKK
FQKRLQEILKQNDFSVTLSGSVDYSDGSQEFSAELTLHSEVLSPEMLQCTPANMVEVHKD
KESNKGHTRHKLEEALINEEAILNLMENSQTFQPLTQRLSDSPVFLDSSPDEALVHLLAG
LESDGYQGERNRMPSPCRSFGNSKYPQNSDDEENEPQIEKEEMELSLVMSQRWDSNIEEH
CAKKRSLCRSNHRSSTEDDDSSSEEEMEWSDNSLLLANLSIPQLDGTADENSDNPLNNEN
SRTHSSVIATSKLSVKPSIFHKDAATLEPSSSAKITFQCKHTSALSSHVLNKEDLIEDLS
QTNKNIEKGLDNSVTSFTNESTYSMKYPGSLSSGVHSENSHKENSKKDILPVSSCESSIF
DYEEDIPSVTRQVPSRKYTNIRKIEKDSPFIHMQRHPNENTLGKNSFNFSDLNHSKNKLS
SEGNEKGNSTALSSLFSSSFTENCELLSCSGENRTMVHSLNSTTDESGLNKLKIRYEEFQ
EHKTEKPSLSQQAAHYMFFPSVVLSNCLTRPQKLSPVTYKLQPGNKPSRLKLNKKKLAGH
QETSTKSSESGSAKDNCVQNNLCNSNPEKDNALASDLTKTTRGGFENKTPTDGFIDCHFG
DGTLETEQSFGLYGNKYTLRAKRKVNYETEDSESSFVTHNSKISLPHPMEIGESLEGTLK
SRKRRKMSKKLPPVIIKYIIINRFRGRKNMLVKLGKIDSKEKQVILTEEKMELYKKLAPL
KDFWPKVPDSPATKYPIYPLTPKKSHRRKSKHKSAKKKTGKQQRTNNENIKRTLSFRKKR
SHAILSPPSPSYNADTEDCDLNYSDVMSKLGFLSERSTSPINSSPPRCWSPTDPRAEEIM
ATAEKEAMLFKGPNVYNSKTVNSRIGKNSRARTQVKKSKAKLVNPSVVTKKRNKRNQTNK
LVDDGKKKPRAKQKTVEKGTTRKHITLKDEKIKSQSGAEVKLALKHQNVSELAGSSGGSQ
LLFKQKDLPLMSSAVDHPLSAPLPIGINAQQKLSGCFPSFLESKKSVDLQTFPSSRDDFH
PSVCNSVGPGISKINVQRPHHQSAMFTLKESTLVQKNIFDLSNHLSQVAQNTQISLGVMS
PKIDDNANNIQKNYLSSVGKLSEYRNSLEAKPDQAYTPNFLHCKDSQQQIVCIAEQSKHS
ETCSPGNGASEESQMPNNCFVTSLRSPVKQIAWEQKPRGFILDMSNFKPEKVKQRSLSEA
ISQTKALSQCKNQNVSTPSALGEGQSGLAVLKELLQKRQQKAQNANIIQDSLSNKHQPNK
NISGSLEHNKANKRTRLVTSPRKPRTPRSTKPKEKIPKLLKVDSLNFQNSSQLDNSLSDD
SPIFFSDPGFESCYSLEDSLSPEHNYNFDINTIGQTGFCSFYSGSQFVPADQNLPQKFLS
DAVQDLFPGQAIEKHEFLSHDSQKCDEDKYHAADSASWIRSGTLSPEMFEKSSIDSNENH
RHNQWKNSFHPLTTRSNSIMDSFCVQQAEDCLNEKSRLNRSSVSKEVFLSLSQPNNSDWI
QGHSRKEMGQSLDSVNTSFSAILSSPDGELVDMACEDLELYVSRNNDVLTPTPDSSPRST
SSPSQSKNGSFTPRTAHILKPLMSPPSREEIMATLLDHDLSETIYQEPFCSNPSDVPEKP
REIGGRLLMVETRLANDLAEFEGDFSLEGLRLWKTAFSAMTQNPRPASPLRSGQGVVNKG
SSNNPKMVEDKKIVIMPCKCAPSRQLVQVWLQAKEEYERTKKLPKTKPTGVVKSAENFSS
LVNPDGKPVVPPKMDVSPCILPTTAHTKDVDNSQIAIQAPTTGCSQTASESQMLPPVASA
SDPEKDEDHDDNYYINYSSPDSPAIPPWQQAISPDSNALIGDERPSSPVEELRSLAVENL
KPIKDGIQKSPCSEPQEPLVISPINARARTGKCESICLHSTPIIQRKLLERLPETTGLSP
LSIEPKTQKLSNKKGSNTDTLRRVLLTQAKNQFAAVNTPKKETSQIDGPSLNNTYGFKVS
IENLQEAKALHEIQNLTLISVELHARTRRDLEPDPEFDPICALFYCISSDTPLPDTEKTE
LTGVIVIDKDKTVFSQDIRYQTPLLIRSGITGLEVTYAADEKALFHEIANIIKRYDPDIL
LGYEIQMHSWGYLLQRAAALSVDLCQMISRVPDDKIENRFAAERDDYGSYTMSEINIVGR
ITLNLWRIMRNEVALTNYTFENVSFHVLHQRFPLFTFRVLSDWFDNKTDLYRWKMVDHYV
SRVRGNLQMLEQLDLIGKTSEMARLFGIQFLHVLTRGSQYRVESMMLRIAKPMNYIPVTP
SVQQRSQMRAPQCVPLIMEPESRFYSNSVLVLDFQSLYPSIVIAYNYCFSTCLGHVENLG
KYDEFKFGCTSLRVPPDLLYQVRHDITVSPNGIAFVKPSVRKGVLPRMLEEILKTRFMVK
QSMKAYKQDRALLRMLDARQLGLKLIANVTFGYTSANFSGRMPCIEVGDSIVHKARETLE
RAIKLVNDTKKWGARVVYGDTDSMFVLLKGATNEQSFKIGQEIAEAVTATNPKPVKLKFE
KVYLPCVLQTKKRYVGYMYETLDQKDPVFDAKGIETVRRDSCPAVSKILERSLKLLFETR
DISLIKQYVQRQCMKLLEGKASIQDFIFAKEYRGSFSYKPGACVPALELTRKMLTYDRRS
EPQVGERVPYVIIYGAPGVPLIQLVRRPVEVLQDPTLRLNATYYITKQILPPLARIFSLI
GIDVFSWYHELPRIHKATSSSRSEPEGRKGTISQYFTTLHCPVCDELTQHGICSKCRSQP
QHVAVILNQEIRELERKQEQLVKICKNCTGCFDRHIPCVSLNCPVLFKLSRVNRELSKAP
YLRQLLDQF
NT seq 9390 nt NT seq  +upstreamnt  +downstreamnt
atgttttcagtgaggatagtgactgcagactactacatggccagcccgctgcaggggctg
gatacttgccaatcccccctcacccagacccctgtcaagaaggtgccggtggtgcgagtc
ttcggagcgaccccggcaggtcagaagacatgtcttcatctacatggcatctttccttac
ctctatgtgccatatgatggttatggacagcaaccagaaagctatctttctcagatggca
ttcagtatcgacagagcacttaatgtggctttaggcaatccatcttccactgctcagcat
gtgttcaaagtgtcattagtatcaggaatgcctttttatggttatcatgagaaggaaaga
cactttatgaagatctatctttacaatcctgcaatggtgaaaaggatatgtgaacttttg
caaagtggagccataatgaataaattttaccagcctcatgaagcgcatattccctacctc
ctacagctcttcattgactacaatctttatggcatgaatttaataaatctggctgctgtc
aagttccggaaagcaagaaggaaaagtgatacattgcatgcaactggatcctgcaagaat
catttatcaggaaattctcttgctggtactttatttcggtgggaacaagatgaaatacca
agctctttactattggaaggtgttgaaccacagagtacatgtgaattagaagtggatgct
gtagctgctgatatcttaaatcgtctggacatagaagctcaaattggtggaaaccctggt
ctacaggccatatgggaagatgaaaagcaacggcgaagaaacagaaatgaaacttctcaa
attagccaacctgagtcacaagatcacaggtttgtgccagcaacagaaagtgaaaaaaaa
tttcagaagagacttcaggaaattctcaaacagaatgatttctctgtaacattatcagga
tctgtggactacagtgatggatcccaggagttctctgctgagttaacgttgcactctgag
gttctgtctcctgaaatgcttcagtgtacaccagccaatatggtagaagttcacaaagac
aaagagtcaaacaaaggtcacactagacacaaactggaagaagctcttattaatgaagaa
gcaattttgaacctcatggaaaatagtcagacttttcagcctttgacccagagactgagt
gactcacctgttttcctggacagtagtcctgatgaggctctggtacatctacttgctggt
ttggaaagtgatggatatcagggggaaagaaataggatgccatcaccatgtcgctccttt
ggaaatagtaaatatccccaaaacagtgatgatgaagaaaatgaaccacagattgaaaaa
gaggaaatggagcttagtttggtgatgtcccagagatgggacagcaatattgaagaacat
tgtgccaaaaagagatcactgtgcagaagtaaccacagaagttcaactgaagatgatgac
tcatcttcagaagaagaaatggaatggagtgataacagtttgcttctagccaatctttct
atacctcagttagatggaactgcagatgaaaatagtgacaatccattgaacaatgaaaat
tctagaacccactcttctgtaattgcaacaagcaagctatccgtcaaaccctccatcttt
cacaaagatgctgctacattagaaccctcatcttctgctaagattacctttcagtgtaaa
cacacaagtgccctttcttcccatgttttgaacaaggaagatttaattgaagacctttca
cagacaaacaaaaatatagaaaaaggtctagataattcagtcacttcttttacaaatgaa
agcacttactctatgaaatatcctggatctttaagcagtggtgttcattcagaaaattct
cataaagagaatagtaagaaagacatcctcccggtatcttcatgtgaaagtagtattttt
gattatgaagaagatattccatctgttacaagacaagtaccaagtagaaaatatacaaat
attagaaaaatcgaaaaggattccccttttatacatatgcaacgtcaccctaacgagaat
acattgggcaaaaattctttcaacttttctgacttaaatcattcaaaaaataaattatcc
tctgaaggaaatgaaaaaggaaacagcacagctctgagtagtttattctcttcatcattt
actgaaaattgtgaattgctgtcatgctcaggggagaatagaactatggtgcattctctt
aatagcaccactgacgaaagtggactaaataaacttaaaattagatacgaagaatttcaa
gaacataaaacagaaaagccaagcctcagccagcaagcagcacactatatgttttttccc
agtgttgttctttctaactgtcttactagaccacagaaactatctcctgtcacatataaa
ttacaacctggcaataaaccatcccggttaaaattgaataaaaagaaacttgcaggtcat
caggagacttctaccaaaagtagtgagagtggatccgcaaaagataattgtgtacaaaat
aatctttgtaatagtaatcctgagaaggataatgcattggccagtgatttaactaaaaca
actcgtggaggttttgaaaataaaacacccacagatggttttatagactgtcactttgga
gatggaacattagaaactgagcagtcctttggactatatggaaataaatacacacttaga
gccaaacgcaaggtaaattatgagactgaagacagtgagtcaagttttgtaacacacaac
tcaaaaattagcctacctcatcccatggaaattggtgaaagtttagagggaactctcaaa
tctcgaaaacgaagaaaaatgtctaaaaagctgccccctgtcatcataaagtatattatt
attaatagatttagagggagaaaaaatatgcttgtgaagctaggaaaaatagactctaaa
gaaaaacaagtaatattaacagaagaaaaaatggaattatataaaaagcttgcacctttg
aaggacttttggccaaaagttcctgactcccctgcaaccaaatatcccatttatccacta
acaccaaagaaaagtcacagaagaaagtcaaaacataagtctgctaagaaaaaaactggt
aagcaacaaaggacaaataatgaaaatattaaaagaactttgtcttttaggaaaaaacga
tcacatgctattctttctcctccctcaccgtcttacaatgctgacaccgaagattgtgac
ttgaattatagtgatgtcatgtctaaactaggttttctttctgagagaagcacaagtccc
ataaattcttctccacctcgctgctggtctcccacagatccaagagctgaagaaatcatg
gctactgcagaaaaagaggcaatgctatttaagggtcctaatgtatacaatagtaagact
gttaattctcgtataggtaaaaatagtcgcgcaagaacacaggttaagaaatcaaaagca
aagcttgttaatccctctgtagttactaagaaaaggaacaaacgaaatcagacaaataaa
ctagtagatgatggaaaaaagaaaccaagagcaaaacaaaaaacagttgagaaaggtaca
acaagaaagcatataacacttaaggatgaaaaaataaaatctcagtctggtgctgaagtt
aagcttgcactgaaacaccagaatgtatctgaacttgcaggtagttctggaggctctcaa
ctactttttaaacagaaagatttgccactaatgagctctgcagtagatcatcccctttct
gctcctctacccattggaattaatgcacaacagaagttatccggctgctttccttctttc
ttagaaagcaagaagtctgtagatttgcagacattccccagttcacgagatgattttcat
ccatcagtttgtaattctgtaggacctggaatctcaaaaattaatgttcaaaggcctcat
catcaaagtgctatgtttactttaaaggaatcaaccttagttcaaaaaaatatatttgac
ctttccaaccatttgtctcaggtagcacagaatacacagatatctttgggtgtaatgtct
ccaaagatagacgataatgcaaataatatacaaaaaaactatttgtcatcagttggaaag
ttaagtgaatatcgcaattccctagaagcaaagccggaccaagcatatacccctaatttt
ttgcattgcaaggacagtcagcagcagattgtgtgcatagcggaacagtcaaagcacagt
gaaacttgttctccaggaaatggagcttcagaggaaagccaaatgcctaataattgcttt
gtaacttccttgagaagtccagtcaaacaaatagcatgggaacaaaagccaaggggcttt
attttagatatgtcaaattttaaacctgaaaaagtaaaacaaaggtcattatcagaagca
atttcacaaaccaaagcactttctcagtgtaaaaatcaaaatgtgtcaacaccttcagca
cttggtgaaggacagtctggactggcagttctaaaagaattgttacaaaaaagacagcag
aaagcacaaaatgcaaatattatacaagactcattatctaataaacatcaaccaaataaa
aatatttctggttcacttgaacataacaaagcaaataagcggactcgattggtaacatcc
ccaagaaaacctcgaactcccagaagtacaaaaccaaaagaaaaaatccccaaacttctc
aaagtagactctttaaatttccaaaactctagccagttggataactccctatcggatgat
agtcccatctttttttcagatccaggttttgaaagttgttattcacttgaagatagctta
tctcctgaacataactataattttgatattaacacaataggtcagactggattttgtagc
ttttattctggaagtcagtttgtcccagctgatcagaatttgcctcagaagttcctaagt
gatgctgttcaggatctttttccaggacaagctatagaaaaacatgagtttttaagtcat
gacagccaaaaatgtgatgaagacaagtatcatgctgcagactcagcctcatggattaga
tctggtactttgagtcctgaaatgtttgagaaatcatccatagatagcaatgagaatcat
cgccacaaccagtggaaaaacagctttcatcctctaacaactcggtctaattcaataatg
gattctttctgtgttcagcaggcagaagactgtctaaatgaaaaatctagattgaatagg
agttcagtaagcaaagaagtgtttcttagcctctcacagccaaacaattcagactggatt
caaggtcacagcagaaaagaaatgggacagtctcttgattcagtcaatacctcttttagt
gcaatactctcctccccagatggtgaacttgtggacatggcctgtgaagatttagaacta
tatgtttcaagaaacaatgatgtgttgacaccaactcctgatagttcaccaagatctact
agttctccctcacaatctaaaaatggcagtttcactcctcgaactgctcacattctgaaa
ccacttatgtccccaccaagtagggaagaaattatggcaactttgttggatcatgacctt
tcagagactatttaccaggaaccattttgcagtaatccttctgatgtaccagaaaagccc
agggagattggtggacgcctcctcatggtagaaactcgacttgcaaatgatctggctgag
tttgagggagacttttccctggaaggacttcgtctgtggaaaacagcattctcagcaatg
actcaaaatccaaggccagcgtcaccccttcgcagtggccaaggagttgtcaataaaggg
tcaagtaataaccctaaaatggttgaagataaaaaaattgtgattatgccttgcaaatgt
gccccaagtcgacaactggttcaagtgtggcttcaagccaaagaagaatacgaacgtacc
aagaaactgcctaaaaccaagccaactggagttgtaaaatctgctgagaactttagctct
ttagttaacccagatggtaaacctgtagtgcctccaaaaatggatgtaagtccatgtata
ctccccactacagcacataccaaggatgttgataattctcagattgctatacaagcacca
accacaggatgtagtcaaactgcaagtgaaagtcagatgctgccaccagttgcctctgca
agtgatcctgaaaaagatgaagatcatgatgataactattacattaattatagctcccct
gattctccagctattcccccttggcaacaagcaatatccccagattccaatgcattaatt
ggagatgagagaccctcatcaccagtagaggagttacgttcattggctgttgagaactta
aagccaataaaagatggtatacaaaaaagcccctgcagtgagcctcaagagcctctagtg
atatctccaattaatgctagggcaagaactgggaaatgtgaatcaatttgccttcacagt
acaccaatcatacagagaaaacttctggaaaggcttcctgaaacaactggccttagccca
ttatcaatagaaccaaaaacacagaagttgagtaataagaaaggaagtaatactgacact
cttagaagagtactcttaacacaagcaaagaatcaatttgcagcagtaaataccccaaag
aaagaaacttctcagattgatggaccatctttaaacaatacttatggtttcaaagtcagc
atagaaaacctacaggaagcgaaagctttacacgagatacaaaatcttaccctaatcagt
gtggagctgcatgctcgaactagacgagacttagaaccagatcctgagtttgacccaatc
tgtgctctgttctactgcatctcatctgacactccactgccagatacagaaaaaacagaa
ctcacgggtgtaatagtgattgataaagacaagacagttttcagtcaagatatcagatat
cagactccattacttattagatctggaattacagggcttgaagtcacctatgctgctgat
gagaaggcactttttcatgaaattgcaaatataataaagaggtatgatcctgatattcta
ctaggatatgagattcagatgcattcctggggttacctcttacaaagggctgctgcttta
agtgttgacttatgtcagatgatctctcgggtgccagatgacaaaattgagaacagattt
gcagctgaaagagatgattatggatcgtatacaatgagtgagataaatattgttggccga
atcacactaaatctttggagaatcatgagaaatgaggtggctctaactaactacaccttt
gaaaatgtgagctttcatgtgcttcatcagcgttttcccctctttacctttcgagtcttg
tcagattggtttgataacaagacggacctatacagatggaaaatggttgatcattatgtt
agccgtgtacgtggaaatctccaaatgttagaacagctggacctgattgggaaaaccagt
gagatggctagactttttggcattcagtttttacatgtactgacaaggggttcacagtac
cgtgtggaatcaatgatgttgcgtattgcaaagccaatgaactatattcctgtgacacct
agtgttcagcagagatcccaaatgagagccccacagtgtgttcctctaattatggagccg
gaatcccgcttctatagcaactctgttcttgttttggatttccaatcactttatccttct
attgtgattgcatataactattgtttttccacctgccttggccatgtggagaacttggga
aagtatgatgagttcaaatttggctgtacctctctgagagtacctccagatttactttac
caagttaggcatgatatcacagtgtcccccaatggaatagcttttgtcaagccttcagta
agaaaaggtgtactaccaagaatgcttgaagaaattttgaagactagatttatggtgaag
cagtcaatgaaggcttacaagcaagacagagccctgttgcgaatgcttgatgcacgtcag
ctaggacttaagctgatagcaaatgtcacatttggctatacatctgctaatttttctggg
agaatgccatgcattgaagttggtgatagtattgttcacaaagccagagagaccttggaa
cgagctattaaactggtgaatgataccaagaaatggggtgctagggttgtgtatggagat
actgacagtatgtttgtgctactgaaaggagccactaacgagcagtcttttaagattggt
caggaaattgccgaagctgtaactgctaccaatcctaaaccagtgaaattgaagtttgaa
aaggtatatttgccttgtgttttacaaacaaaaaagaggtatgtgggttacatgtatgaa
acactggatcagaaggacccagtatttgatgcaaaaggaatagaaacagttagaagagat
tcctgccctgctgtttctaagatacttgagcgttctctaaagctgctatttgaaacaaga
gatataagtctaattaaacaatatgttcagcgacaatgtatgaagcttctggaaggaaag
gccagcatacaagactttatttttgccaaggaatacagaggaagtttttcttataaacca
ggagcttgtgtgccagcccttgaacttacaaggaaaatgctcacttatgaccggcgctct
gagcctcaagttggggagcgagtgccatatgtcatcatttatggggcccctggagtacca
cttatccagcttgtaagacgcccagtggaagtcctgcaggacccaactctgagactgaat
gccacttactatattaccaagcaaatacttccacccttggcaagaatcttctcacttatt
ggtattgatgtcttcagctggtatcatgaattaccaaggatccataaagctaccagctct
tctcgaagtgaacctgaagggcggaaaggcactatttcacaatattttactaccttacac
tgtcctgtgtgtgatgaactaacacagcatggcatctgtagtaaatgtcggagccaacct
cagcatgttgcagtcatcctcaaccaagaaatccgggagttggaacgtaaacaggagcaa
cttgtaaagatatgcaagaactgtacaggttgctttgatcgacacatcccatgtgtttct
ctgaactgcccagtacttttcaaactctcccgagtaaatagagaactgtccaaggcacca
tatctccggcaattactagaccagttttaa

DBGET integrated database retrieval system