KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100390419Help
Entry
100390419         CDS       T03264                                 

Gene name
DDB2
Definition
(RefSeq) damage specific DNA binding protein 2
  KO
K10140  DNA damage-binding protein 2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03420  Nucleotide excision repair
cjc04115  p53 signaling pathway
cjc04120  Ubiquitin mediated proteolysis
cjc05161  Hepatitis B
cjc05169  Epstein-Barr virus infection
cjc05200  Pathways in cancer
cjc05202  Transcriptional misregulation in cancer
cjc05210  Colorectal cancer
cjc05212  Pancreatic cancer
cjc05213  Endometrial cancer
cjc05214  Glioma
cjc05216  Thyroid cancer
cjc05217  Basal cell carcinoma
cjc05218  Melanoma
cjc05220  Chronic myeloid leukemia
cjc05222  Small cell lung cancer
cjc05223  Non-small cell lung cancer
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Module
cjc_M00385  Cul4-DDB1-DDB2 complex
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100390419 (DDB2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    100390419 (DDB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100390419 (DDB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100390419 (DDB2)
   05202 Transcriptional misregulation in cancer
    100390419 (DDB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100390419 (DDB2)
   05212 Pancreatic cancer
    100390419 (DDB2)
   05225 Hepatocellular carcinoma
    100390419 (DDB2)
   05226 Gastric cancer
    100390419 (DDB2)
   05214 Glioma
    100390419 (DDB2)
   05216 Thyroid cancer
    100390419 (DDB2)
   05220 Chronic myeloid leukemia
    100390419 (DDB2)
   05217 Basal cell carcinoma
    100390419 (DDB2)
   05218 Melanoma
    100390419 (DDB2)
   05213 Endometrial cancer
    100390419 (DDB2)
   05224 Breast cancer
    100390419 (DDB2)
   05222 Small cell lung cancer
    100390419 (DDB2)
   05223 Non-small cell lung cancer
    100390419 (DDB2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100390419 (DDB2)
   05169 Epstein-Barr virus infection
    100390419 (DDB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cjc04121]
    100390419 (DDB2)
   03400 DNA repair and recombination proteins [BR:cjc03400]
    100390419 (DDB2)
Ubiquitin system [BR:cjc04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     100390419 (DDB2)
DNA repair and recombination proteins [BR:cjc03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      100390419 (DDB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40
Motif
Other DBs
NCBI-GeneID: 100390419
NCBI-ProteinID: XP_002755275
Ensembl: ENSCJAG00000020000
UniProt: F6XWJ8
Position
11
AA seq 427 aa AA seqDB search
MAPKKRPETQKTSKIVLRPRSKRSRSPRELEPEAKKLCAKGSGPSRRCDSDCLWAGLAGP
QILPPCRSIVRTLHQHKLGRASWPSVQQGLQQSFLHTLDSYRILQKAAPFDRRATSLAWH
PTHPSTVAVGSKGGDILLWNFGIKDKPTFIKGIGAGGSITGLKFNPLNTNQFYASSMEGT
TRLQDFKGNILRVFASSDTINIWFCSLDVSANSRMVVTGDNVGNVILLNMDGKELWNLRM
HKKKVTHVALNPCCDWFLATASVDQTVKIWDLRQVRGKASFLYSLPHRHPVNAACFSPDG
ARLLTTDQKSEIRVYSASQWDCPLGLIPHPHRHFQHLTPIKAAWHPRYNVIVVGRYPDPN
FKSCTPYEMRTIDVFDGNSGKMMCQLYDPESSGISSLNEFNPMGDTLASAMGYHVLIWSQ
EEARTRK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggctcccaagaaacgcccagaaacccagaagacctccaagattgtattacgccccagg
agcaagaggagcaggagtccccgggagctggagcccgaggccaagaagctctgtgcgaag
ggctccggtcctagcagaagatgtgactcagactgcctctgggcggggctggctggccca
cagatcctgccaccatgccgcagcattgtcaggaccctccaccagcataagctgggcaga
gcttcctggccatctgtccagcaggggctccagcagtcctttttgcacactctggattct
taccggatattacaaaaagccgccccctttgacaggagggctacatccttggcatggcac
ccgactcaccccagcaccgtggctgtgggttccaaagggggagatatcttgctctggaat
tttggcatcaaggacaaacccaccttcatcaaagggattggagctggagggagcatcact
gggctgaagtttaaccctctcaataccaaccagttttacgcctcctcaatggagggaaca
actaggctgcaagactttaaaggcaacattctacgagtttttgccagctcagacaccatc
aacatctggttttgtagcctggatgtgtctgccaatagccgaatggtggtcacaggagac
aatgtggggaatgtgatcctgctgaacatggacggcaaagagctttggaatctcagaatg
cacaaaaagaaagtgacgcatgtggccctgaacccatgctgtgattggttcctggccaca
gcctccgtagatcaaacagtgaaaatctgggacctgcgccaggttagagggaaagccagc
ttcctctactcgctgccgcacaggcatcctgtcaacgcagcttgtttcagtccggatgga
gcccggctcctgaccacggaccagaagagcgagatccgagtttactctgcctcccagtgg
gattgccccctgggcctcatcccgcaccctcaccgtcacttccagcacctcacacccatc
aaggcggcctggcatcctcgctacaatgtcattgtcgtcggccgatacccagatcctaat
ttcaaaagttgtactccctatgaaatgaggacaatcgatgtgttcgatggaaactcaggg
aagatgatgtgtcagctctacgacccagaatcttctggcattagttcgctcaatgagttc
aatcctatgggggacacgctggcctctgcaatgggttaccacgttctcatttggagccag
gaggaagccaggacacggaaatga

DBGET integrated database retrieval system