KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100390439Help
Entry
100390439         CDS       T03264                                 

Gene name
HADHA
Definition
(RefSeq) hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit
  KO
K07515  enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00062  Fatty acid elongation
cjc00071  Fatty acid degradation
cjc00280  Valine, leucine and isoleucine degradation
cjc00310  Lysine degradation
cjc00380  Tryptophan metabolism
cjc00410  beta-Alanine metabolism
cjc00640  Propanoate metabolism
cjc00650  Butanoate metabolism
cjc01100  Metabolic pathways
cjc01200  Carbon metabolism
cjc01212  Fatty acid metabolism
Module
cjc_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
cjc_M00085  Fatty acid elongation in mitochondria
cjc_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    100390439 (HADHA)
   00650 Butanoate metabolism
    100390439 (HADHA)
  09103 Lipid metabolism
   00062 Fatty acid elongation
    100390439 (HADHA)
   00071 Fatty acid degradation
    100390439 (HADHA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100390439 (HADHA)
   00310 Lysine degradation
    100390439 (HADHA)
   00380 Tryptophan metabolism
    100390439 (HADHA)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100390439 (HADHA)
Enzymes [BR:cjc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     100390439 (HADHA)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     100390439 (HADHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-GeneID: 100390439
NCBI-ProteinID: XP_002758005
Ensembl: ENSCJAG00000008008
UniProt: F6VL40
Position
14
AA seq 763 aa AA seqDB search
MVACRAIGILGRFSAFRILRSRGYICRNFTESSALLTRTHINYGVKGDVAIIRINSPNSK
VNTLSKELHSEFVEVMNEIWASDQIRSAVLISSKPGCFIAGADINMLAACKTPQEVTQIS
QEAQRTLEKLEKSTKPVVAAISGSCLGGGLELAVSCQYRIAIKDRKTVLGTPEVLLGILP
GAGGTQRLPKMVGVPAAFDMMLTGRNIRADRAKKMGLVDQLVEPLGPGLKPPEERTIEYL
EEVAITFAKGLADKKISPKRDKGLVEKLTAYAMTIPFVRQQVYKKVEEKVRKQTKGLYPA
PLKIIDVVKTGIEQGSDAGYLSESQKFGELAMTKESKALMGLYHGQVLCKKNKFGAPQKD
VKHLAILGAGLMGAGIAQVSVDKGLKTILKDATLTGLGRGQQQVFKGLNDKVKKKALTSF
ERDSIFSNLTGQLDYQGFEKADMVIEAVFEDLSLKHRVLKEVEAVIPDHCVFASNTSALP
ISEIAAVSKRPEKVIGMHYFSPVDKMQLLEIITTEKTSKDTSASAVAVGLKQGKVIIVVK
DGPGFYTTRCLAPMMSEVIRILQEGVDPKKLDSLTTSFGFPVGAATLVDEVGVDVAKHVA
EDLGKAFGERFGGGNPELLTQMVSKGFLGRKSGKGFYIYQEGVKSKNLNSDMDNILASLK
IPPKSEVSSDEDIQFRLVTRFVNEAVMCLQEGILATPAEGDIGAVFGLGFPPCLGGPFRF
VDLYGAQKLVDRLKKYEAAYGKQFTPCQLLADHANSPNKKFYQ
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atggtggcctgccgggcgattggcatcctcggccgtttctctgccttcaggatcctccgc
tcccgaggttatatatgtcgcaattttacagagtcttctgctttgctgaccagaacccat
attaactatggagtcaaaggggatgtggcaattattcgaattaactctcccaattcaaag
gtaaatacactgagtaaagagctgcattcagagttcgtagaagttatgaatgaaatctgg
gctagtgatcaaatcagaagtgccgtccttatctcatcaaagccaggctgctttattgca
ggtgctgatatcaacatgttagctgcttgcaagacccctcaagaagtaacacagatctca
caagaagcacagagaacacttgagaaacttgaaaagtccacaaagcctgttgtggctgcc
atcagtggatcctgcctgggaggaggacttgagcttgctgtttcatgccaatacagaata
gcaataaaagacagaaaaacagtattaggtacccctgaagtcttgttggggatcttacca
ggagcagggggcacgcaaaggctgcccaaaatggtgggtgtgcctgctgcttttgacatg
atgctgactggtagaaacattcgtgcagacagggcaaagaaaatgggactggttgaccaa
ttggtggaacccctgggaccaggactaaaacctccagaggaacggacaatcgaataccta
gaagaagttgcaattacttttgccaaaggactagctgataagaagatctctccaaagaga
gacaagggattggtggaaaaattgacagcgtacgccatgactattccatttgtcaggcaa
caagtttacaaaaaagtggaagaaaaagtacgaaagcagactaaaggcctttatcctgca
cctctgaaaataattgatgtggtaaagactggaattgagcaagggagtgatgctggttat
ctctctgaatctcagaaatttggagagcttgcaatgaccaaagaatcaaaggccttgatg
ggactctaccatggtcaggtcctgtgcaagaagaataaatttggagctccacagaaggat
gttaagcatctggctattcttggtgcagggctgatgggagcaggcatcgcccaagtctct
gtggataaggggctaaagactatacttaaagatgccacactcactgggctaggccgagga
cagcaacaagtgttcaaaggattgaatgataaagtgaagaagaaagctctaacatcattt
gaaagggattccatcttcagcaacttgactgggcagcttgattaccaaggttttgaaaag
gccgacatggttattgaagctgtgtttgaggaccttagtcttaagcacagagtgctaaag
gaagtagaagcggtgattccagatcactgtgtctttgccagtaacacatctgctctccca
atcagtgaaatcgctgctgtcagcaaaagacctgagaaggtgattggcatgcactacttc
tctcctgtggacaagatgcagctgctggagattatcacaaccgaaaaaacttccaaagac
accagtgcttcagctgtagcagtcggtctcaagcaggggaaggtcatcattgtagttaag
gatggacctggcttttataccaccaggtgtcttgcacccatgatgtctgaagtcatccga
atcctccaggaaggagttgacccgaagaagctggattccctgaccacaagctttggcttt
cctgtgggtgccgcgacactggtggatgaagttggcgtggatgtagcaaaacatgtggca
gaagatctgggcaaagcctttggggagcggtttggaggtggaaacccagaactgctgaca
cagatggtctccaagggcttcctaggtcgaaagtctgggaagggcttttacatctatcag
gagggtgtgaagagtaagaatttgaattctgacatggataatattttagcgagtctgaag
atacctccaaagtctgaagtctcctcagacgaagatatccagttccgcctggtgacaaga
tttgtgaatgaggcagtcatgtgcctccaggaggggatcttggccacacctgcagaggga
gacatcggagccgtctttggacttggcttcccaccctgtcttggagggcctttccgcttt
gtggatctgtatggtgcccagaagctagtggaccgactcaagaagtatgaggctgcctat
ggaaaacagttcacgccctgccagctgctagctgaccatgctaacagccctaacaagaag
ttctaccagtaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100390793Help
Entry
100390793         CDS       T03264                                 

Gene name
ECHS1
Definition
(RefSeq) enoyl-CoA hydratase, short chain 1
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00062  Fatty acid elongation
cjc00071  Fatty acid degradation
cjc00280  Valine, leucine and isoleucine degradation
cjc00310  Lysine degradation
cjc00380  Tryptophan metabolism
cjc00410  beta-Alanine metabolism
cjc00640  Propanoate metabolism
cjc00650  Butanoate metabolism
cjc01100  Metabolic pathways
cjc01200  Carbon metabolism
cjc01212  Fatty acid metabolism
Module
cjc_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
cjc_M00085  Fatty acid elongation in mitochondria
cjc_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    100390793 (ECHS1)
   00650 Butanoate metabolism
    100390793 (ECHS1)
  09103 Lipid metabolism
   00062 Fatty acid elongation
    100390793 (ECHS1)
   00071 Fatty acid degradation
    100390793 (ECHS1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100390793 (ECHS1)
   00310 Lysine degradation
    100390793 (ECHS1)
   00380 Tryptophan metabolism
    100390793 (ECHS1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100390793 (ECHS1)
Enzymes [BR:cjc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     100390793 (ECHS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-GeneID: 100390793
NCBI-ProteinID: XP_002756776
Ensembl: ENSCJAG00000005233
UniProt: U3BLA7
Position
12
AA seq 290 aa AA seqDB search
MAALRVLLPRVRGPLRPPIHSSVWRPFASGANFEYIIAEKRGKNNTVGLIKLNRPKALNA
LCNGLIEELNQALKTFQEDPAVGAIVLTGGDKAFAAGADIKEMQNMSFQECYSQKFLNHW
DCITQVKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLT
RAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAERIASNSKIIVAIA
KESVNAAFEMTLTEGNKLEKKLFYSTFATDDRKEGMAAFVEKRKANFRDQ
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggccgctcttcgtgtcctgctgccccgcgtccgcggcccactgaggcccccgatccac
agctcggtgtggcgtcccttcgcctcgggtgccaactttgagtacatcatcgcagaaaaa
agggggaagaataacaccgtggggttgatcaagctgaaccgccccaaggcccttaatgca
ctttgcaatgggctgattgaggagctcaatcaggcactgaagaccttccaggaggacccg
gccgtgggggccattgtcctcaccggcggggataaggcctttgcagctggagctgatatc
aaggaaatgcagaacatgagtttccaggagtgttactcccagaagttcttgaaccactgg
gactgcatcacccaggtcaagaagccggtcatcgctgctgtcaatggctatgctcttggc
gggggctgtgagcttgccatgatgtgtgacatcatctatgccggcgagaaggcccagttt
ggacagcccgagatcttactagggaccatcccaggtgcaggaggcacccagagactcacc
cgtgctgtcgggaagtcgctggcgatggagatggtcctcaccggtgatcggatctcagcc
caggatgccaaacaagcaggtcttgtaagcaagatttttccagttgagacactggtggaa
gaagccatccagtgtgcagaaagaattgccagcaattccaaaatcatagtagcaatagcc
aaagaatcagtgaatgcagcttttgaaatgacattaacagaaggaaataagttggagaag
aaactcttttattcaacctttgcaactgatgaccggaaagaagggatggccgcgtttgtg
gaaaagagaaaggccaacttcagagaccagtga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100395397Help
Entry
100395397         CDS       T03264                                 

Gene name
EHHADH
Definition
(RefSeq) enoyl-CoA hydratase and 3-hydroxyacyl CoA dehydrogenase
  KO
K07514  enoyl-CoA hydratase / 3-hydroxyacyl-CoA dehydrogenase / 3,2-trans-enoyl-CoA isomerase [EC:4.2.1.17 1.1.1.35 5.3.3.8]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00071  Fatty acid degradation
cjc00280  Valine, leucine and isoleucine degradation
cjc00310  Lysine degradation
cjc00380  Tryptophan metabolism
cjc00410  beta-Alanine metabolism
cjc00640  Propanoate metabolism
cjc00650  Butanoate metabolism
cjc01100  Metabolic pathways
cjc01200  Carbon metabolism
cjc01212  Fatty acid metabolism
cjc03320  PPAR signaling pathway
cjc04146  Peroxisome
Module
cjc_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
cjc_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    100395397 (EHHADH)
   00650 Butanoate metabolism
    100395397 (EHHADH)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100395397 (EHHADH)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100395397 (EHHADH)
   00310 Lysine degradation
    100395397 (EHHADH)
   00380 Tryptophan metabolism
    100395397 (EHHADH)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100395397 (EHHADH)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100395397 (EHHADH)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    100395397 (EHHADH)
Enzymes [BR:cjc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     100395397 (EHHADH)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     100395397 (EHHADH)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     100395397 (EHHADH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 UDPG_MGDP_dh_N TrkA_N NAD_binding_2 Peptidase_S49 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 100395397
NCBI-ProteinID: XP_002758183
Ensembl: ENSCJAG00000014856
Position
15
AA seq 722 aa AA seqDB search
MAEYTRHNALALIRFRNPPVNVISMALLREMEEGLQKAVTDHTIKAIVICGAEGKFSAGA
DIHGFSAPRTFGLSLGSVVDEIQRNVKPVVAAIQGMALGGGLELALGCHYRIAHAEARVG
LPEVTLGLVPGARGTQLLPRLIGVPAALDLITTGRHILAGEALKLGILDKVVNSDLLEEA
IRFAQRVSDQPLESRRLFKKPIQSLPNMDSIFGEALLKMRKQHPGCLAQEACVRAVQAAV
QYPYEVGSKKEEELFQYLLQSGQARALQYAFLAERKANKWSSPSGASWKTASAQPVSSVG
VVGLGTMGRGIVISFARARIPVIAVDSDKNQLATANKIITSVLEKEASKMQQSGHPWSGP
KPRLTSSMKELGGVDLVIEAVFEDMSLKKQVFAELSAVCKPEAFLCTNTSSLDVDEIASS
TNRPHLVIGTHFFSPAHIMKLLEVIPSQYSSPTTIATVMNLSKKIKKIGVVVGNCFGFVG
NRMLNPYYSQTYFLLEEGSKPEEVDRVLEEFGFKMGPFRVSDLAGLDVGWKSRKGQGLTG
PTLPPGTPARKRGSRRYCPIPDVLCELGRFGQKTGKGWYQYDKPLGRIHKPDPWLSKFLS
QYRETHHIEPRIISRDEILERCLYSLINEAFRILGEGIAASPEHIDVVYLHGYGWPRHRG
GPMFYASTVGLPAVLEKLQKYYRQNPDIPQLEPSDYLKKLASQGNPPLKEWQSLAGPPSS
KL
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atggccgagtatacgcggcacaacgccttggcgctgatccgcttccgaaacccgccggtc
aacgtgatcagtatggctttactccgtgaaatggaagaaggactacagaaagctgtaaca
gaccatacaataaaagccattgtgatttgtggagcagagggcaaattttctgcaggtgct
gatattcatggcttcagcgctcctaggacctttggcttatcactgggaagtgtagtagat
gaaatacagagaaatgtgaagcccgtggtggcagcaatccaaggcatggctttaggagga
ggactagagctggccctgggctgtcactataggattgcccatgcagaggctcgagttggc
ttaccggaagttacactgggacttgtccctggtgcaagaggaacccagcttctcccaaga
ctcatcggagttcctgctgcacttgacttaattaccacaggaagacatattttagcaggt
gaagcactcaagctgggcattctagataaagtcgtgaactcagacctgcttgaagaagca
atcagatttgctcagagagtttcagatcaacctttagaatcccgtagactcttcaagaag
ccaattcagagcttgcccaacatggactccattttcggtgaggccctcttgaagatgcgg
aagcagcaccctgggtgtcttgctcaggaggcttgtgtccgagcggtccaggctgctgtg
cagtatccctatgaagtgggcagcaagaaggaggaagagctgtttcaatatcttttgcaa
tcagggcaggcaagagccctacaatatgctttcttagctgaaaggaaagcaaataagtgg
tcatctccctccggagcatcgtggaaaacagcatcagcgcagcctgtctcctcggttggt
gttgtcggcttgggaacaatgggccgaggcatcgtcatctcttttgcaagggccaggatt
cctgtgattgctgtagactcagacaaaaaccagctagcaactgcaaacaagataataacc
tctgtcttggaaaaagaagcatccaaaatgcaacagagtggccacccttggtcaggacca
aaacccaggttaacttcatctatgaaggagcttggtggtgtagatttagtcattgaagca
gtatttgaggacatgagcctgaagaagcaggtctttgctgaactctcagctgtgtgcaaa
ccagaagcttttttgtgcaccaatacttcatccctggacgttgatgagattgcttcttcc
acaaatcgtcctcacttggtcattggcactcacttcttttccccagctcatatcatgaag
ttgttagaggttattcccagccaatactcttcccccactactattgccactgttatgaac
ttatcaaaaaagattaaaaagattggggtcgttgtaggcaactgttttggatttgtgggg
aatcgaatgttgaatccttattacagtcagacatatttcttattagaagaaggcagcaag
ccagaggaggtagatcgggtgctggaagagtttggttttaaaatgggaccttttagagtg
tccgatcttgctgggttggacgtgggctggaaatctagaaaggggcaaggtcttaccgga
cctacattgcctccaggaactcctgcccgaaaaagaggcagtaggagatattgcccaatt
cctgatgtgctctgtgaattaggacgatttggccagaagacaggtaagggctggtatcaa
tatgacaagccattgggtaggattcacaaacctgatccgtggctttccaaattcctatca
cagtatagagaaacccatcacattgaaccacgtatcatcagccgggatgagatcctcgag
cgctgcttatattcacttatcaatgaagcattccgtatcttgggagaagggatagctgct
agcccagagcacatcgatgttgtctatttacatggatacggatggccaaggcacaggggc
gggcccatgttctatgcttccacagttgggttgcccgcagttctagagaagttgcagaaa
tattacaggcagaaccctgatattccccaactggagcccagtgactatctaaaaaagctg
gcttctcagggaaaccctcccctgaaagaatggcaaagcttggcaggcccccccagcagc
aaattgtga

DBGET integrated database retrieval system